(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0137

AL591973.LMO0137     Location/Qualifiers
FT   CDS_pept        139960..140853
FT                   /transl_table=11
FT                   /gene="lmo0137"
FT                   /note="similar to oligopeptide ABC transporter, permease
FT                   protein"
FT                   /db_xref="GOA:Q8YAI9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAI9"
FT                   /protein_id="CAC98352.1"
FT                   /translation="MRLDFSKKTMQDFERDAEVVHATRERSFWRFMLADRRAVFATSVL
FT                   ILITVACIFAFLSPYDPNALSVQDKLMPPNSSHWFGTDDHGRDYLTRVLYGGRVSLLVG
FT                   VFAMMIAVVVGTLAGTVSGYFGGFIDNIVMRFLDIFMSIPSFFLLMILNAYLKPGISNI
FT                   IIIIGLLSWMEVARIVRAETLTLKEREFILYSKSSGGGFFHIMFKHIIPNAMPSIVVAA
FT                   SLNVATAILTESALSFLGLGVQQPNASWGSMLNNAQGYVGEATYLALFPGLLILMTILS
FT                   FNVLGDVLRKGLSRRY"
     atgcgattag atttttcgaa aaaaacaatg caagatttcg agcgggatgc agaagtcgtt        60
     cacgcaacac gagagcggag tttttggcgc tttatgcttg ctgaccgccg cgctgttttt       120
     gcgacgagtg tgctgatact tattacggtg gcttgtattt ttgcgttcct ttcgccttat       180
     gaccctaatg ctctttccgt tcaggacaaa ctgatgccgc caaattcgtc gcactggttt       240
     gggacggatg accatggtcg ggattacttg acgcgtgtct tgtacggtgg ccgggtttcg       300
     ctacttgtcg gtgtgtttgc gatgatgatt gccgttgtcg ttggaacgct cgctgggaca       360
     gttagtggct actttggtgg cttcattgac aatatagtga tgcgttttct tgacattttc       420
     atgtcgattc cgtcattttt cctactaatg attttaaatg catacttaaa accgggaatt       480
     tcgaacatta ttatcattat cggattgctt tcttggatgg aagtggcgcg gatagttcga       540
     gcggagacgt taacattaaa agaacgtgaa ttcattttat actccaagtc atcaggtggc       600
     ggatttttcc acatcatgtt caagcacatt attccaaacg cgatgccatc gattgttgtt       660
     gcagcttcat taaacgtcgc tacagccatt ttaaccgagt cagcactaag tttccttggc       720
     ctcggcgttc aacagcctaa cgcttcgtgg ggcagcatgc tgaacaatgc gcaaggttac       780
     gtcggcgaag caacttactt ggcgcttttc cccggattat taattttaat gacgattctt       840
     tcatttaacg tacttggcga cgtgctgaga aaaggtttgt cacgtagata ttaa             894
//

If you have problems or comments...

PBIL Back to PBIL home page