(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0154

AL591973.LMO0154     Location/Qualifiers
FT   CDS_pept        151186..151890
FT                   /transl_table=11
FT                   /gene="lmo0154"
FT                   /note="similar to high-affinity zinc ABC transporter
FT                   (ATP-binding protein)"
FT                   /db_xref="GOA:Q8YAH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAH2"
FT                   /protein_id="CAC98369.1"
FT                   /translation="MKYIDIANIGFKYESEPVLENISFQVSAGEFIILTGENGAAKSTL
FT                   LRIILGILQPDKGSVTFAKKNADGGRLLTGYVPQQIASFNAGFPSTVLELVRSGRFPNG
FT                   KWFKRLTTKDHAHVEKALKSVEMWDYRHKRIGELSGGQKQRICLARMFATDPDILILDE
FT                   PQTAMDKQSKIRFYNLLKHEAQVHGKAILMVTHDSEEMEDFVDKHIRLIRKEDVSWKCF
FT                   SMDLCKEPSKRP"
     atgaaataca tcgatatagc caatattggt tttaaatacg aatcagagcc agtgcttgaa        60
     aacatttctt ttcaagtgag tgcgggagaa tttattatac taacaggaga aaacggagca       120
     gctaaatcaa cactgctccg tattattttg ggcattttac aacccgataa aggttccgtg       180
     actttcgcca aaaagaacgc agatggcggg cgacttttga caggttatgt accgcaacaa       240
     atagcttcat ttaatgctgg ttttccaagt acagttctcg aattagtaag gtcaggacgt       300
     tttccgaatg gtaaatggtt caaacggctg actacaaaag atcatgcgca tgttgaaaaa       360
     gcattaaagt ctgtagaaat gtgggattat cgtcataaac gtatcggcga gttatctggt       420
     ggacaaaagc agcggatttg cttagcgcga atgtttgcaa cagacccaga tatattaatt       480
     ttggatgaac cacagacggc gatggataaa caaagtaaaa tccgttttta taatttatta       540
     aagcatgaag cgcaagtaca tggtaaagcg attttgatgg taacacatga tagtgaagaa       600
     atggaagact ttgtggataa gcatattcgc cttattagaa aggaggatgt gtcatggaaa       660
     tgtttctcta tggatttatg caaagagcct tccaagcgtc catga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page