(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0158

AL591973.LMO0158     Location/Qualifiers
FT   CDS_pept        155993..156805
FT                   /transl_table=11
FT                   /gene="lmo0158"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAG8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAG8"
FT                   /protein_id="CAC98373.1"
FT                   /translation="MYKIIAIDIDGTLLNDTHEITPAVRDSIKAAKAKGVKVVLCTGRP
FT                   LAGIKKSLIELDLLDEGDYAITFNGAVVLETASEKTLADITLNKTELEEIYAFCHAENV
FT                   NVTYFDGKNMYVPSRKITEITCQDSLLLGTPLYHLPVEEAPESIHVSKVMLLDSPEKIT
FT                   DVIKKLPENIKEKFYVVRSVPYNLEFLQKGVNKGSALASLADKLGVDQSEVMSIGDQEN
FT                   DITMIEYAGMGVAMGNATEHIKEIANYTTTTNNEDGVAQAIQMLILDR"
     atgtataaaa ttattgcgat agatattgat ggcactttat taaacgacac acacgaaatc        60
     acaccagctg tgcgtgattc tattaaagct gcgaaagcaa aaggggtaaa agtagtatta       120
     tgtacaggtc gtccacttgc aggaattaaa aaaagcttaa ttgaactaga tcttttagat       180
     gaaggggatt acgcaattac gtttaatggg gcggttgtgt tagaaacagc ttcagaaaaa       240
     acattagcag atataacctt aaataaaact gagctagaag aaatttatgc attttgtcac       300
     gcggaaaatg ttaacgtcac ttattttgat ggaaaaaaca tgtatgtacc aagccgcaaa       360
     atcacagaaa tcacttgtca agattcgctg ctacttggta cgccactata tcatttacct       420
     gtagaagaag cgcctgaatc tattcatgtt tccaaagtta tgctattaga ctcacctgaa       480
     aaaattaccg atgtgataaa aaaattacca gagaatatca aagaaaaatt ttacgttgtc       540
     cggagtgttc catataactt agagttcttg caaaaagggg ttaataaagg atcagcgctc       600
     gctagtttag cagataaact tggggtggac caaagtgaag tcatgagtat tggagatcag       660
     gaaaacgata ttaccatgat cgagtacgct ggtatgggag ttgcgatggg aaatgcgaca       720
     gagcatatta aagaaatcgc caactataca acaactacta ataatgaaga tggtgtggca       780
     caggctattc aaatgcttat tctggaccga taa                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page