(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0160

AL591973.LMO0160     Location/Qualifiers
FT   CDS_pept        159663..161378
FT                   /transl_table=11
FT                   /gene="lmo0160"
FT                   /product="putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /db_xref="GOA:Q8YAG6"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAG6"
FT                   /protein_id="CAC98375.1"
FT                   /translation="MKERTTMMSNLKKFGLAFLSVILLVNVIFQTNFVKAATNYGSDFL
FT                   KTVELLDADGNPQTDFGYYDSIKVHYTWEIPNSTNVKEGDTMEFVLPPELKIVTDLDFS
FT                   LKDHDGNTVGHVIAKKSTGQVVITFTDFVEKNSNISGYLDFWTNWDKSLVEGNENVPVE
FT                   FPVNGTTETIDVGVGGKNQIDPDESLYKYGWADAENPELIQWVVRVNYSKQNIQNAVYE
FT                   DFIGPKQVVDFNSIKAFHGEFDPDDNFTPGAEVPSSAITQTTDGFKVDLGNLTDSVKIS
FT                   YYTTSTDNGASPNYTNKGQLTGDNFIKQEIEVATPTSGGGGGGEGTTGSVELTKTDDSS
FT                   QKNPLEGAEFKLVNGAGATVQTGLKTNADGKLAISNLKYDTYQLIETKAPQGYVLDASP
FT                   VKFTIDDTHQSLFVSKENTAIKGSVSLEKVDRDTKSLLADAEFELQDKDGNTLKTNLKT
FT                   DQKGKLTVADLLPGEYQFVETKAPTGYILDTTPLKFKISTEALNVTVTKENTKKPEIPK
FT                   VPVPPKKPEKPDKIISEDSKQTALPKTGDSPLVNGWGLLLVAISASGLIALRRK"
     atgaaggaac gcacgacaat gatgtctaat ctaaagaaat tcggattagc atttcttagc        60
     gttatcttgc ttgtaaacgt tatatttcag actaactttg ttaaagcagc aactaattat       120
     gggtccgatt ttttgaaaac tgttgaatta ttagatgcag atggaaatcc ccaaacggac       180
     ttcgggtatt atgatagcat caaggttcac tatacttggg aaatccccaa ttcaactaat       240
     gttaaggaag gcgacacaat ggaatttgtg ttacctccag agctgaagat agttacagat       300
     ttagactttt ctttaaaaga tcacgatggc aacacggtag gtcatgtgat tgctaaaaaa       360
     tcgactggcc aagtagttat tacatttaca gactttgtcg aaaaaaactc caatattagt       420
     ggatatctcg atttttggac taattgggat aaatcattag tagaaggtaa tgaaaatgtt       480
     ccagttgaat ttccagtaaa tggtaccaca gaaacaattg atgtgggtgt tggaggcaaa       540
     aatcaaatcg acccggatga aagcttatat aaatacggct gggctgatgc tgaaaatcct       600
     gagcttatcc agtgggttgt gcgagttaac tattccaaac aaaacattca aaatgccgtt       660
     tatgaagact ttattggacc aaaacaagtc gttgatttta attcaataaa agcattccac       720
     ggcgagtttg acccggatga taacttcaca ccaggagctg aggtgccttc atctgcaatt       780
     actcaaacaa cggatggttt taaagttgat ctaggaaatt taacagattc tgtcaaaatt       840
     tcatactaca caacttctac cgacaacgga gcatcgccta actacactaa taaagggcaa       900
     ttaacaggcg ataacttcat taaacaagaa atcgaagtcg caacaccaac atcaggaggc       960
     ggcggtggtg gagaagggac aactggttct gttgaattaa cgaaaacaga tgattcgtcc      1020
     caaaaaaatc cgctagaagg tgccgaattt aagttagtca acggagcagg agccactgtg      1080
     caaacgggat taaaaaccaa tgctgatgga aaactggcaa tttcaaacct gaaatatgac      1140
     acataccagc taatcgaaac gaaagctcca caaggatacg tgttggatgc gtctccagtg      1200
     aaattcacga ttgatgatac ccaccaatca ttattcgtat ctaaagaaaa tactgccatc      1260
     aaaggatccg tttcactaga aaaagtcgac cgtgacacaa aaagtcttct agctgatgcc      1320
     gaattcgaat tacaagataa agatggtaac acactaaaaa caaatcttaa aacggaccaa      1380
     aaaggtaaac taacggttgc tgatttactt ccaggtgagt atcaatttgt tgaaacaaaa      1440
     gcaccaacag gttatatttt agacactaca ccattgaaat ttaaaatcag cacagaagca      1500
     ttaaacgtaa ctgtaacaaa agaaaatacg aaaaaaccag aaataccaaa agtgccagta      1560
     ccaccaaaaa aaccagaaaa accggataaa ataataagtg aagacagcaa acagacagct      1620
     ttaccaaaaa caggagattc gccacttgtt aatggatggg gactgttact cgtagccatt      1680
     tcagcgagcg gcttaattgc acttagaaga aaataa                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page