(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0162

AL591973.LMO0162     Location/Qualifiers
FT   CDS_pept        162467..163459
FT                   /transl_table=11
FT                   /gene="lmo0162"
FT                   /note="similar to B. subtilis DNA polymerase III (delta'
FT                   subunit)"
FT                   /db_xref="GOA:Q8YAG4"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAG4"
FT                   /protein_id="CAC98377.1"
FT                   /translation="MGLQDELTMMQPVVMKIFSKSVRENRLSHGYLFEGTRGTGKKRTA
FT                   LWLAQSLFCLESTETELACGKCTNCTRIASHNHPDVHLLEPDGASIKIDQVRALKQELS
FT                   KRGMESDQKVVIIYDAEKMTVQSANSLLKFIEEPEGGLLLLFLTTNPGQILPTIQSRLQ
FT                   PVTFKSLTFDSLLASLTAAGISEQKARIYASITGSVEEAKAFEESEWFSEARNVVIKLY
FT                   EGIHHQGTSPLIIIQESWMPLFKEKDKMALGLELLLLLYRDRLHLTLDENYEPICTAQK
FT                   EMLGQDALRKSLSETTGEIEKILAAKSKLDSNMNTQLLMEQLVLEIQGR"
     gtgggattac aggatgaact tacaatgatg caaccagtgg tcatgaagat tttttcaaaa        60
     agtgtccgcg aaaatcgatt atctcacggc tatttattcg aaggaacaag gggtacaggg       120
     aagaagcgca cagcactttg gttagctcag agcctttttt gtttagaaag cactgaaacc       180
     gagcttgctt gtggaaagtg taccaattgc acgagaatag cgagtcataa tcatccggat       240
     gttcatttgc tagagccaga tggggctagt attaaaattg atcaggttcg cgcgcttaag       300
     caagaactta gtaaacgtgg gatggaatcg gatcaaaaag tagttatcat ttacgatgca       360
     gaaaaaatga ctgttcaatc agccaatagt ctgctgaaat ttatagaaga accagaaggc       420
     ggtttgttat tattattttt aacaacaaat cccgggcaaa ttttgccaac aatccagtca       480
     agactgcaac cggtcacatt caaatcactg acttttgata gtttactcgc atcactaaca       540
     gcagcaggca tttccgaaca aaaagcgcgg atttatgcta gcattactgg gagtgtggaa       600
     gaagcgaagg cttttgaaga gagcgagtgg tttagtgagg caagaaatgt tgtcatcaag       660
     ttatacgaag gaattcacca tcaaggaacc agcccattaa ttatcattca agaatcatgg       720
     atgccacttt ttaaagagaa agataagatg gcgcttgggc tcgaattgtt gttactgctg       780
     taccgcgacc ggctacacct tacacttgac gagaactacg aaccaatttg tacagcgcaa       840
     aaagaaatgc tcggacaaga tgcgctgcgc aagtcactgt ccgaaaccac aggggaaatc       900
     gagaagattc tcgctgcgaa atcaaaactg gattccaata tgaacacgca acttctaatg       960
     gagcagttag ttctggaaat ccaagggagg taa                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page