(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0164

AL591973.LMO0164     Location/Qualifiers
FT   CDS_pept        164309..164698
FT                   /transl_table=11
FT                   /gene="lmo0164"
FT                   /note="similar to B. subtilis YabA protein"
FT                   /db_xref="GOA:Q8YAG2"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAG2"
FT                   /protein_id="CAC98379.1"
FT                   /translation="MDKKAIFDSVSNMEEQIGELYQQLGDLKTNLGEMLEENNRLNLEN
FT                   EHLRRRLSLTDEATPEPKAETEAEHGVMAPNRKEAMQQMIELGEGYDNLVQLYKEGFHV
FT                   CNVHFGSPRGNDEDCLFCLSLLNKK"
     ttggataaaa aagctatttt tgactcagtc agtaatatgg aggagcaaat tggcgaattg        60
     tatcagcaac ttggagatct aaagacaaac ttaggcgaaa tgttggaaga aaataaccga       120
     ttaaaccttg aaaacgaaca tttgcgacgc agactttctt tgaccgatga agcgacaccg       180
     gaacctaaag ccgaaacaga ggcggaacac ggtgtaatgg cgcctaatcg taaggaagca       240
     atgcagcaaa tgattgaact tggggaaggt tatgacaatc ttgtccaact ttacaaggaa       300
     ggatttcatg tttgcaatgt acatttcggc agcccgcgtg gtaatgatga agattgttta       360
     ttttgcttat ccttgctcaa taaaaaataa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page