(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0166

AL591973.LMO0166     Location/Qualifiers
FT   CDS_pept        165492..165764
FT                   /transl_table=11
FT                   /gene="lmo0166"
FT                   /note="similar to B. subtilis YazA protein"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAG0"
FT                   /protein_id="CAC98381.1"
FT                   /translation="MAKASEHFFYVLKCSDNSYYGGYTTDVLRREAEHNAGIRCKYTKT
FT                   RRPVKVIHFEKFETRSEATKAEAAFKKLSRKNKDAYLIQREEESE"
     atggcgaaag cgagtgaaca tttcttttat gtgctaaaat gtagtgataa ttcatattat        60
     ggtggctata caactgatgt tcttcgccga gaagcagaac acaatgcggg aattagatgt       120
     aaatatacaa aaacgcgtcg tccggtaaaa gtcatccatt ttgaaaaatt cgaaacaaga       180
     agtgaagcta caaaagcaga agctgcgttc aaaaaattat cacgtaaaaa taaagacgct       240
     tatttaatac aacgggagga ggagtccgag tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page