(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0167

AL591973.LMO0167     Location/Qualifiers
FT   CDS_pept        165761..166642
FT                   /transl_table=11
FT                   /gene="lmo0167"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAF9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAF9"
FT                   /protein_id="CAC98382.1"
FT                   /translation="MIKSQKSFSGTSQGALYLVPTPIGNLEDMTFRAIRMLKEADIIAA
FT                   EDTRNTVKLLNHFEITTRMTSYHQFTKENKEDNIIQRMLGGEVVALVSDAGMPSISDPG
FT                   YELVQSALDANIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQAIEKLAA
FT                   REETWILYESPHRLKETLKAIIKITGNDRKIVLCRELTKRFEEFLRGTVEDALNWAMDE
FT                   EIRGEFCLIIEGNSNPQLAEEQLWWQELDIKTHVSTVMEQENVSSKDAIKTVMKARNLP
FT                   KREVYSAYHEIK"
     gtgataaaaa gtcaaaagag tttcagcgga accagccaag gggcattata tttagtgccg        60
     acgccgattg gtaatttaga agatatgact tttcgtgcaa ttcgcatgct taaagaagcg       120
     gatattattg cagcggaaga tacgcgaaac accgtgaaac ttttaaatca ttttgaaatt       180
     acaacccgaa tgacgagtta tcatcagttt acgaaggaaa ataaagaaga taatattatt       240
     cagcgaatgc tgggcggaga agtggtggcg ctagtgagtg atgctgggat gccatctatt       300
     tctgacccgg gatacgaact tgttcaaagt gcgttagatg ctaatattcc tgtcatccca       360
     ttaccgggag ccaatgctgc attaactgca ctgattgcat ctggtcttgc cccgcagccg       420
     ttttactttt acggatttct tccacgccaa aacaaagagc gtactcaagc gattgaaaag       480
     ttggcggctc gtgaagaaac gtggatttta tatgaatcac cacatcgttt aaaagaaaca       540
     ctaaaagcaa tcattaaaat cactggaaat gatcggaaaa tcgtcctgtg tcgagagctc       600
     acaaaaagat ttgaagaatt tttgcgtgga acggttgaag atgcgctgaa ctgggcaatg       660
     gacgaagaaa tccgcgggga attttgcttg attatcgaag gcaattccaa cccacaactt       720
     gcagaagagc agctctggtg gcaagaactc gatattaaaa cgcacgtaag caccgtaatg       780
     gaacaggaaa atgttagttc taaagatgca atcaaaaccg ttatgaaagc gagaaattta       840
     ccaaaacgag aagtttactc tgcttatcat gaaataaaat aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page