(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0168

AL591973.LMO0168     Location/Qualifiers
FT   CDS_pept        complement(166687..166971)
FT                   /transl_table=11
FT                   /gene="lmo0168"
FT                   /note="similar to B. subtilis transcription regulatory
FT                   protein AbrB"
FT                   /db_xref="GOA:Q8YAF8"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAF8"
FT                   /protein_id="CAC98383.1"
FT                   /translation="MKSTGMVRKIDELGRVVIPIEIRRTMNLNVKDPLEIFTDEDAIIL
FT                   KKYSAGLVCDVTGEFSVDNKKFVDGKLTLSKEGAAALMEEIKRRFGDTL"
     atgaaatcaa ctggaatggt aagaaaaatc gacgaacttg gtcgtgtggt tatcccgatt        60
     gaaataagaa ggacaatgaa cctaaatgta aaagatccct tagaaatttt tacagatgaa       120
     gatgcgatta tattgaagaa gtattctgct ggcttggttt gtgatgttac cggagaattt       180
     tctgttgata ataagaaatt tgtggacggc aaactgacgc ttagtaaaga aggtgctgcg       240
     gcattaatgg aagaaattaa acgccgcttt ggcgatacat tataa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page