(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0169

AL591973.LMO0169     Location/Qualifiers
FT   CDS_pept        167086..167943
FT                   /transl_table=11
FT                   /gene="lmo0169"
FT                   /note="similar to a glucose uptake protein"
FT                   /db_xref="GOA:Q8YAF7"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAF7"
FT                   /protein_id="CAC98384.1"
FT                   /translation="MNIVIALIPAVMWGIMPLVVSKIGGKPRQQIIGTTFGALAFAIGV
FT                   FIFTNPEYTATIIIASFVSGAFWSLGQMNQFRAFTQVGVSKTMPLSTGMQLVGTSLFGV
FT                   FAFHEWGTTSKLVLGFSALALIIIGIFLTSYQQHKDENSGQNMKKGIITLLISSVGYVG
FT                   YVVITRWFDISGWDAILPQAIGMVVAGLLFSIKSEEKRFTKQTWLNMIPGVMWATGNLA
FT                   LLFSNKLVGIATGFSLSQMGVVISTIGGILFLGEKKTKKELILVIIGVVLVIIGGTMIG
FT                   IAKS"
     atgaacatag ttatagcatt aattccggca gtgatgtggg ggattatgcc attagttgtt        60
     tcgaaaattg gtggtaagcc gaggcaacaa attattggta caacgttcgg ggcattagca       120
     ttcgcaatcg gagtttttat ttttacaaat ccagagtata cggcaaccat aattattgct       180
     agttttgtct ctggggcatt ttggagctta ggccaaatga atcagttccg ggcatttaca       240
     caagtaggcg tatcaaaaac aatgccgctt tcaaccggaa tgcagttagt aggtacatca       300
     ctttttggtg tattcgcctt tcatgagtgg ggtacaactt ccaaattagt attaggattt       360
     tccgcattag cattaattat tatcgggata tttttaacaa gttatcaaca acataaagac       420
     gaaaattccg gtcaaaatat gaaaaaagga attatcactt tacttatttc ttcagtaggt       480
     tatgtaggtt atgtagttat cactcgttgg tttgatatta gtgggtggga cgcgatttta       540
     cctcaagcaa ttgggatggt agtcgcagga ttattatttt ctattaagtc tgaagaaaaa       600
     cgttttacaa agcaaacgtg gttaaatatg attccagggg tgatgtgggc tactggtaac       660
     ttggctctac tattctcaaa taaattggtt ggaatcgcca caggtttttc gctctcacaa       720
     atgggcgttg tcatttcaac aattggagga attcttttct taggagagaa aaaaaccaag       780
     aaagaactta ttttggtcat tatcggagta gtcttagtaa ttatcggtgg cacgatgatt       840
     ggaattgcaa aaagctaa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page