(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0171

AL591973.LMO0171     Location/Qualifiers
FT   CDS_pept        169510..172008
FT                   /transl_table=11
FT                   /gene="lmo0171"
FT                   /note="similar to internalin proteins, putative
FT                   peptidoglycan bound protein (LPXTG motif)"
FT                   /db_xref="GOA:Q8YAF5"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAF5"
FT                   /protein_id="CAC98386.1"
FT                   /translation="MRKIPVVVSLALCFSLVSPSLYASADTITAVQITKEATTDTTEPT
FT                   TIDQPSRMDNSQTAPQKMTASSSEEAATTNSTEEENTPKNNLKSTSENSKTYAELFPDV
FT                   NLAKIIAKNISGTEDINAEVSEAELQTITNLVATNQNITSLTGIEHLTALENINVNNNE
FT                   LTTIDSLFNIPTLKSISANNNKITGNFSLVKTLPELHTLEVLGNAITELDIENQPNLVT
FT                   LSADELELKKLTLKNLSQLNGLGRIASSISIDWGDLESVTLMNLPEIISVDISGNYLDS
FT                   DDIHLENLPAVKNLDISSNELTRLPKINDFPLLTTINVRSNKIDRLESSKLVDVPKLAT
FT                   LNADKQAVTLSKTIAAGNFTIPNNVENLAGQMVTPKIISNNGTYSDQSIAWASGELSGL
FT                   SKVSYTFDEVINSPAIAGKYTGTVNQPIEVKAVPVIVADKSVSYAPVNAKDEATFLQDI
FT                   RASASENAQITSDYSEVVDFATPGDYTVTLHAKNEFDLKADPVTVVVHINDIQKPQVAV
FT                   NSNDISFEVGTELTSEVLLAKSGAVVTDLYDEAIKMEVDLSEVDSSKLGTYEATIIAKS
FT                   KSGASSDPIKLSVKIVDTEKPIIQINNPEIIIEKGSELTEGQIIDQVGITATDNYDQDL
FT                   NIHMDLSKVDTSKPGSYEVTIYTEDSSGNRSETVTITVKVPEARIGKITIQYMDSENNE
FT                   LAESNTITGEVGETYETLAKEIEGYTLKENPANSSGVFEETRQTIQYIYVKDIINPEFP
FT                   VYSENNVTPELPSNNNNSVNGSRQTPSKSVKKQSKAYSKINQMPMNLPETGDSTNLLFI
FT                   FMGVLLLAGLTLSKAKRKNQ"
     atgagaaaaa taccagttgt tgtttctctt gctttgtgtt ttagcctagt aagtcctagt        60
     ttgtatgcta gtgcagatac tataactgcg gtccaaatca ctaaggaagc aacaaccgac       120
     actacagaac ctacaactat tgaccagcct agcagaatgg acaactcgca aaccgcacca       180
     cagaaaatga cagcatcatc cagtgaagaa gctgcaacta ctaactcaac tgaagaggaa       240
     aatacaccta aaaataattt gaaatcaact tctgaaaaca gcaaaacata tgctgaacta       300
     tttccggatg ttaatttagc caaaataata gctaaaaata ttagtggaac agaagatatt       360
     aatgcagaag tatcagaagc agaattacaa actattacta atttagtagc aacaaaccag       420
     aatattacga gcttaactgg catagagcat ttaacagcgt tagaaaatat caatgtgaac       480
     aacaatgagc tcacgacaat agattcgtta tttaatatac caaccttaaa atcaattagc       540
     gcgaataata ataaaataac ggggaatttt agtttggtaa aaactttgcc ggaattacac       600
     acgttagaag tgcttggtaa tgcaattaca gagttagata ttgaaaacca acctaaccta       660
     gtaactttgt cggcagatga attagaattg aaaaagctaa cgttgaaaaa tttatcccaa       720
     ttaaacggac taggaagaat agcttccagt atttctattg actggggtga tctagagagc       780
     gtcactttaa tgaatttacc agaaataata agcgtagata ttagtgggaa ttatttagac       840
     agtgatgata tacatttgga gaaccttcct gcagttaaga acctggatat cagtagtaat       900
     gaactaactc ggctaccgaa aattaacgat tttccgcttc tgactacaat taatgtaaga       960
     agtaataaaa tagataggct agaatcaagt aaactagtcg atgtaccaaa acttgcgaca      1020
     ctaaatgcgg ataaacaagc cgttacgctt tcaaaaacga tagcagcagg gaactttacg      1080
     ataccgaata acgttgagaa cttagcggga caaatggtta caccgaaaat aatttccaac      1140
     aacggaactt actctgatca aagcatcgca tgggcaagcg gagaactatc aggcttatca      1200
     aaagtttctt atacatttga tgaagtgatt aatagtccgg caattgctgg caagtacact      1260
     ggaacagtaa accaaccaat tgaagtcaag gcagtacctg taattgtagc ggataagagt      1320
     gtttcgtacg cgcccgtaaa tgcaaaagat gaggcgacat ttttacaaga tattcgtgcg      1380
     tctgcttcgg aaaacgcaca gattactagc gattatagcg aggtagtcga ctttgcaact      1440
     ccgggagatt atacagtcac gctacatgct aaaaatgagt ttgacttaaa ggcagatccg      1500
     gttaccgttg tcgtgcatat taatgatatt caaaaaccac aagtcgcggt taactcgaac      1560
     gatatttcat ttgaagtagg aacagaatta actagtgaag tgcttcttgc taaatctggc      1620
     gcggtagtta cggatctata cgacgaagca attaagatgg aagttgactt gtccgaagtg      1680
     gattcaagca aacttggaac gtatgaagcg acgataatag caaaaagcaa aagtggtgct      1740
     tcctcggatc caatcaaact ttctgttaaa atagtcgata ccgaaaaacc tattattcaa      1800
     attaacaatc cggaaataat tattgaaaaa ggcagcgaat taacagaggg tcaaatcatt      1860
     gaccaagttg gaataactgc aacagataat tatgatcaag atttaaatat ccacatggat      1920
     ttatctaaag tagatacttc caagccaggc agttatgaag taaccattta tacagaagat      1980
     tcatctggta atcgttcaga aacagtaacg atcaccgtga aagtaccaga agctagaata      2040
     gggaaaatta ctattcaata tatggatagt gaaaacaatg aattagctga aagtaatacg      2100
     attactggcg aagttggtga aacgtatgaa acacttgcta aagaaattga aggctatacg      2160
     ctaaaagaaa atccagctaa ttcaagtggg gtttttgaag aaactagaca aacgattcaa      2220
     tatatttacg tgaaagatat aattaaccca gaatttccag tatacagcga aaacaacgta      2280
     acaccagaac tcccaagtaa caataataac tcggtcaatg ggtccaggca aacaccaagt      2340
     aaatcagtaa agaaacagtc aaaggcatac tcgaaaatta atcaaatgcc aatgaatctt      2400
     ccagaaacag gagatagcac aaatttactc tttattttta tgggtgttct gttattagct      2460
     ggattaaccc tctctaaagc taaaagaaaa aatcaataa                             2499
//

If you have problems or comments...

PBIL Back to PBIL home page