(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0175

AL591973.LMO0175     Location/Qualifiers
FT   CDS_pept        complement(173309..174556)
FT                   /transl_table=11
FT                   /gene="lmo0175"
FT                   /product="putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /db_xref="GOA:Q8YAF4"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAF4"
FT                   /protein_id="CAC98390.1"
FT                   /translation="MFNKKKTIASLIVLSSLASQIALTPISALADTHDTNNIALLQNTN
FT                   ENVPYKYTSTLTFPTLTNQTQEDYKLEIKLALPSGMNYTDLQVSVGGEDITNQVGTTSF
FT                   DNSTNTVTFKFDKVTSWDSLSKAKVKFDWKTSYSGEGGEAKIDSLVATATATSEDKAGN
FT                   KSTSTGSLKPKDISAPVVKAEETEITYSPGSDVTEEQFLTDIHASVTDNYDSTISLTSN
FT                   FTSAVNLAVSGDYSVNVQATDKAGNVSNTLNVTVHVSTPAPVAGANITVNHLDSNGNKI
FT                   AESDTLTGVVNSNYQSESKKITGYTLETTPTNATGTFTDTPQTVDYIYKKDTVTPTPIT
FT                   VNPVEPVKPVNPVVNKPVTVKPANDNTNPSTSNSVEKTTYSSLPTTGDTDQSKSSTIFG
FT                   ALLLLISAPLLLFKKK"
     atgtttaata agaaaaaaac tatcgctagc cttatagttt taagttctct agctagtcaa        60
     atagcactta cacctatttc tgcacttgct gatactcacg atacaaataa tattgcatta       120
     ctacaaaata ccaatgagaa tgtcccatat aaatacacat ccactcttac atttccaact       180
     ttaacgaatc aaacccagga agactataaa ctggaaataa aattagcgct accaagtggc       240
     atgaactata cggacttaca ggtttctgtt ggtggggaag acattacaaa ccaagttggg       300
     acaactagct ttgacaattc cactaacact gttactttta aattcgacaa agtaacaagt       360
     tgggatagtt tatccaaagc aaaagtaaag ttcgactgga aaacttctta ttcaggtgaa       420
     ggtggagaag ccaagattga ttctttagtt gcgaccgcaa cagctacaag cgaagacaaa       480
     gctggtaaca aatccacctc cactggctct ttaaaaccaa aagatattag cgcaccagtt       540
     gttaaagcag aagaaacaga aatcacatac agccctggaa gtgatgttac ggaagaacaa       600
     tttttaacag acattcatgc tagcgttact gataattatg actccactat tagtcttaca       660
     agcaatttta cttccgcagt taatttagca gttagtggtg attactcggt caatgttcaa       720
     gcaaccgata aagcaggtaa cgtctcaaat acactaaatg tcaccgttca tgtgtctact       780
     cctgcacccg tagctggggc aaacatcact gtgaatcatc ttgatagcaa tggtaataaa       840
     atcgcagaat cagatacatt aactggagtt gtcaacagta attatcagtc agaaagcaaa       900
     aaaattaccg gttatacttt agaaactaca cctacaaacg caactggtac tttcactgat       960
     actccacaaa cagttgatta tatttataaa aaagataccg taacacctac accaattact      1020
     gttaatccag ttgaaccggt taaaccagtt aatccagtag ttaataagcc tgtaactgta      1080
     aaaccagcta atgataatac taatcctagt actagtaatt ctgtagaaaa aacaacttat      1140
     agctctttac caacaactgg tgatactgac caaagtaaat catccactat cttcggagcc      1200
     ttgcttcttt taatcagtgc cccgttacta ttatttaaaa agaaataa                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page