(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0176

AL591973.LMO0176     Location/Qualifiers
FT   CDS_pept        174834..175694
FT                   /transl_table=11
FT                   /gene="lmo0176"
FT                   /note="similar to glucose uptake protein"
FT                   /db_xref="GOA:Q8YAF3"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAF3"
FT                   /protein_id="CAC98391.1"
FT                   /translation="MNIMIALIPALLWGTVPLIITKFGGSTRQQTMGMTLGALTFAVIV
FT                   FFFTDPVYTLKTVGISFITGCLWTVGQMFQLQAFKIIGVSKAMPISTGMQLVGTTLCGV
FT                   ILFHEWDTTLRIILGFIALALIVGGIFLTSYAEKEEDGTNALKQGLITLFISACGYVGL
FT                   VVLIQGFKIDGINAILPQAIGMVISALIMTHSGGTEKRFNKRTLLLTIPGVIWAAGNVA
FT                   MVHANQLVGVATGFSLSQLGVVISTIGGIILLKEKKTQKEMLFVIVGVVLVVLGGILIG
FT                   VAKGA"
     ttgaacatta tgattgcgct gattcctgca ttactttggg gaacagtccc gctaattatt        60
     acaaaatttg gcggttcaac aagacaacaa acgatgggaa tgacactagg ggcactcact       120
     tttgcggtaa tcgttttctt ctttactgat ccagtttata cgcttaaaac agtagggatt       180
     agttttataa caggatgttt atggactgtt ggtcagatgt tccaactgca agcattcaaa       240
     attatcggtg tttcaaaagc aatgccgatt tctacaggga tgcaattagt tggaacaaca       300
     ctttgcgggg taatcttatt tcatgaatgg gatacgacac ttcgaattat tttaggtttt       360
     atagcattag ctcttatcgt cggtggaatt ttcttaacat cttatgctga aaaagaagaa       420
     gatggtacta atgcattaaa acaaggtttg atcacattat tcatttctgc ttgtggttat       480
     gttggcttag ttgttctaat tcaaggtttc aaaatcgatg gaattaatgc gattttgccg       540
     caagcgattg ggatggttat aagtgcgcta attatgacac acagtggtgg tacggaaaaa       600
     cgcttcaata aacgaactct cttacttact attccaggag tgatttgggc agctggaaac       660
     gttgcgatgg ttcacgctaa ccaacttgtt ggagtcgcaa ctggtttttc actttcgcaa       720
     ttaggagttg ttatctcaac tattggaggt atcatacttt taaaagaaaa gaaaacgcaa       780
     aaagaaatgc tttttgttat tgtgggcgta gttttagttg ttctcggcgg gattttaatc       840
     ggcgttgcaa aaggcgctta a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page