(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0180

AL591973.LMO0180     Location/Qualifiers
FT   CDS_pept        180052..180900
FT                   /transl_table=11
FT                   /gene="lmo0180"
FT                   /note="similar to sugar ABC transporter, permease protein"
FT                   /db_xref="GOA:Q8YAF0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAF0"
FT                   /protein_id="CAC98395.1"
FT                   /translation="MKTEKSGSPKWQLFKNILTYTIICLGGIIMLMPFVWMVSTAFKTG
FT                   AANMVLPPQFIPKEPTTANFTQVFEMFPMLRFLVNSVIVAVVTTLGQMLFCSMAAYAFA
FT                   RIPFWGRDKLFLLYLATMMVPAQVTMIPQFILMKQFGWLDSYAGLIVPALFSVFGTFLL
FT                   RQAFMGIPKELEEAAFMDGANHFTIFRKVILPLAKPTFATLGILTFMQSWNSYLWPLIV
FT                   TSSQEMATLPLGLSLLQGRYGTNYGLMMAGVLISVIPILAVYLFAQKYFIQGMAMSGMK
FT                   E"
     atgaaaacag aaaaaagtgg ttcaccaaaa tggcaactat tcaaaaatat tcttacctat        60
     acaatcatct gtcttggtgg gattatcatg cttatgccat ttgtctggat ggtatcaact       120
     gcattcaaaa caggcgcagc gaatatggta ttaccaccac aatttattcc taaagaaccg       180
     acaactgcga acttcactca agtatttgaa atgttcccaa tgttgcgatt tttagttaac       240
     tccgtgatag ttgcagttgt aacaacactc ggtcaaatgc tgttttgttc aatggcagcg       300
     tatgcatttg ccagaattcc tttctggggt cgcgataaac tatttttact ttacttggca       360
     acaatgatgg taccggctca ggttacgatg attccacaat ttatcttgat gaaacaattt       420
     ggctggttag attcttatgc aggtttgatt gtaccagcat tattcagcgt ttttggtaca       480
     tttttattac gtcaagcatt catgggaatt ccgaaagaat tagaagaagc tgcatttatg       540
     gatggagcaa atcattttac tattttccga aaagttatct tgccgcttgc aaaacctaca       600
     tttgcgacac ttggaatttt aacttttatg caatcttgga acagttattt atggccatta       660
     atcgtgacaa gttcacaaga aatggcaact ttacctttag gattatctct tttacaaggt       720
     agatatggca cgaattacgg cttaatgatg gcgggagttc ttattagtgt tatcccgatt       780
     ttagcagtgt acctttttgc tcaaaaatat ttcatccaag gaatggcaat gagcggaatg       840
     aaagaataa                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page