(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0181

AL591973.LMO0181     Location/Qualifiers
FT   CDS_pept        180928..182184
FT                   /transl_table=11
FT                   /gene="lmo0181"
FT                   /note="similar to sugar ABC transporter, sugar-binding
FT                   protein"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="PDB:5F7V"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAE9"
FT                   /protein_id="CAC98396.1"
FT                   /translation="MKKGLLLLMVVVLSVFGLSACGGGSSSGDKTEITYYQFSAPADGK
FT                   ALDEMVKEFEKQNPDIKVNVQTIAFNDYFTKLQTQIAGGDAPDAFELNYETFMQYAEKG
FT                   VLADLTSYIEKDKDFDPSTLNKQAYDAFKYDGKQYGMVESFSNVVTIYNKDLFDKAGVE
FT                   YPTADWTWKDEEAAAKKLTDAKNKVWGTSQPVTMNEFYKVAAQNGGSIFNEDLTETTIN
FT                   SPENVEALTHLTNEVTDSKVAPSPADLSGQLPEDLFMNGQIAMLHTGIWLFDMFQDAPF
FT                   KWDVQVEAGNTQKATHFFANGIGVSKDSDKKEAAFKFASFMSANEEAAKIRIDNNWELP
FT                   ATENKEILQPYLDATPPDNREAVFESLQYMVLPPVVKDWNKISDYTNSEFEKVLNGDST
FT                   PEKALKNSEDNINKTMGFK"
     atgaaaaaag gtttattatt gttaatggta gttgtactgt ctgtatttgg tctttcggct        60
     tgcggcggtg gcagtagtag tggcgataaa acagaaatta cgtattatca attctctgca       120
     ccagctgatg gaaaagcact tgatgaaatg gtaaaagaat ttgaaaagca aaacccagat       180
     attaaagtaa acgttcaaac aatcgcattt aatgattact tcacgaagct gcaaacgcaa       240
     atcgcaggtg gagatgctcc tgatgctttt gaacttaact atgaaacatt catgcaatat       300
     gctgaaaaag gtgtacttgc agatttaaca agctatatcg aaaaagataa agattttgat       360
     ccatctacgc ttaacaaaca agcctacgat gctttcaaat atgacggtaa acaatacggc       420
     atggtagaaa gtttctccaa cgttgtaaca atttacaata aagacctttt tgataaagcc       480
     ggcgttgaat acccgacagc tgactggact tggaaagacg aagaagcggc agcgaaaaaa       540
     ttaacagatg ctaaaaataa agtttgggga acttcccaac cagtaacaat gaacgaattc       600
     tacaaagtag cagcgcaaaa tggtggttcg attttcaatg aagatttaac ggaaacaact       660
     attaacagcc ctgaaaatgt ggaagcactg actcacttaa caaatgaagt aactgattca       720
     aaagttgcgc cttcaccagc tgatttatct ggacaattac cagaagattt attcatgaat       780
     ggtcaaattg caatgcttca cacaggtatt tggttgttcg atatgttcca agatgctccg       840
     ttcaaatggg atgtacaagt agaagcaggt aacacacaaa aagcaaccca cttcttcgcg       900
     aacggaattg gtgtttctaa agactccgat aaaaaagaag ctgcattcaa atttgcttcc       960
     ttcatgagtg cgaacgaaga agcagcaaaa atcagaattg ataataactg ggaacttcca      1020
     gcaacagaaa acaaagaaat tctacaacca tatttagatg caactcctcc agataataga      1080
     gaagcggtat tcgaatctct acaatatatg gtattacctc cagttgtgaa agattggaac      1140
     aaaatcagtg attatacaaa ctctgaattc gaaaaagtat taaatggcga ttctacccca      1200
     gaaaaagcac tgaaaaacag tgaagacaac atcaacaaaa caatgggatt taaataa         1257
//

If you have problems or comments...

PBIL Back to PBIL home page