(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0186

AL591973.LMO0186     Location/Qualifiers
FT   CDS_pept        190690..191916
FT                   /transl_table=11
FT                   /gene="lmo0186"
FT                   /note="similar to B. subtilis YabE protein"
FT                   /db_xref="GOA:Q8YAE4"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAE4"
FT                   /protein_id="CAC98401.1"
FT                   /translation="MTMENSSNVAQSSKWKLPIMIAGFVIVVALVFYFVFEGTKNDITI
FT                   VNAGEKIESRTHAKTVSEALDEAGIKVSERDEIAPGKNAEIKDGMEIKYLPARQITIND
FT                   NGTKKDVWSTKANVADLLKDENITTRPQDVLNVALDTKLKNGLEVNINRAIQLSLQNGA
FT                   KKDTVWTTKTKVSDLLAEKNIKLDQDDRVSPAKDSNLKEKMTVEVTYVNSKAEKKNEQV
FT                   KFETVYKEDDSLNKGVEKVVQEGKNGKKVVEYKVTFENGKEKKRDVIKENVTSNKTDKV
FT                   VVRGTKEKVVATPVSNVSTSSATSSSSSSASSTPSGGKTYKMESTAYSGGGTTAYGINL
FT                   SANPGLKVIAVDPRIIPLGSKVWVEGYGEAIAGDTGGAIKGNIVDVYFPNESQCYSWGR
FT                   RMVTVKVLN"
     atgaccatgg aaaacagcag taacgtagcc caatcatcaa aatggaaatt accaatcatg        60
     attgcaggat ttgttattgt agtagcattg gttttttatt tcgttttcga aggaactaaa       120
     aacgatatca ctatagtaaa cgctggtgaa aaaattgaat caagaacaca tgcgaaaact       180
     gtttcagaag cattagacga agcaggcatt aaagtaagtg aacgcgatga aattgcacca       240
     ggcaaaaatg cagaaatcaa agacggcatg gaaattaaat atttgccagc tcgtcaaatt       300
     acaataaatg ataatggtac taaaaaagac gtttggagta caaaagcaaa cgtagcagac       360
     ttgcttaaag atgaaaacat tacaactcgt ccgcaagatg tattaaacgt agcattagat       420
     actaaattga aaaatggtct tgaagtgaac attaatcgtg ccattcaact ttccttacaa       480
     aacggagcaa aaaaagatac agtatggaca acaaaaacaa aagttagtga tttactagct       540
     gagaaaaata ttaaacttga tcaagatgac cgtgtgtcac ctgcgaaaga cagtaactta       600
     aaggaaaaaa tgactgtaga agttacatat gtcaattcaa aagcagaaaa gaaaaatgaa       660
     caagttaaat tcgaaacagt atacaaagaa gacgatagcc taaacaaagg cgttgaaaaa       720
     gtcgttcaag aaggtaaaaa cggcaaaaaa gttgttgagt ataaagtaac atttgaaaat       780
     ggcaaagaga aaaaacgcga tgtcattaaa gaaaatgtta cttctaataa aactgataaa       840
     gtagttgtac gcggcacgaa agaaaaagtg gttgcaacac cagtttctaa cgtatccact       900
     tcaagtgcaa cgtcttcatc atcgtcatca gcatcatcaa ctccatcagg tggtaaaaca       960
     tacaaaatgg aatctactgc atattcaggt ggcggtacta cagcttatgg tatcaaccta      1020
     agtgctaacc ctggactaaa agtaattgcg gttgatccac gaattattcc acttggctct      1080
     aaagtttggg ttgaaggata cggagaagca atcgctggag atactggcgg cgctatcaaa      1140
     ggaaatatcg ttgatgtgta tttcccaaat gaaagtcagt gctattcatg gggtagaaga      1200
     atggtgactg tcaaagtatt aaactaa                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page