(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0187

AL591973.LMO0187     Location/Qualifiers
FT   CDS_pept        192018..192593
FT                   /transl_table=11
FT                   /gene="lmo0187"
FT                   /note="similar to B. subtilis YabF protein"
FT                   /db_xref="GOA:Q8YAE3"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAE3"
FT                   /protein_id="CAC98402.1"
FT                   /translation="MSGKPVIHEFIVVEGRDDTTAINRSVIADTIETNGSALSQETIEK
FT                   IRHAQELRGVIIFTDPDFPGEKIRKQIDSAVPGCKHAFINRQDALPKAGRGLGVEHASS
FT                   ANIREALENFHTSGAPTEKQFISKDILVHLGLLGGVGAKERREKIGNILKIGYTNGKQL
FT                   QTRLESFAISEEQLVAACQKIMQEEENE"
     atgagcggga agcctgtaat acatgaattt atagtcgtag aaggacggga cgatacaacg        60
     gcaattaatc gttcagttat tgccgatacc attgagacta atggatctgc cctttcacaa       120
     gaaacaatag aaaaaattag acatgcgcaa gaacttcgcg gcgttattat ttttacagat       180
     ccagattttc caggtgaaaa aatccgaaaa caaattgact cagcggtacc aggctgtaaa       240
     cacgctttta tcaatcgcca agatgcttta ccaaaagctg gtcgcggcct tggagtggaa       300
     catgccagta gcgctaatat tcgtgaagca ttagaaaact tccatacgag tggggcgccc       360
     actgaaaaac aatttatttc caaagatatt cttgttcatc tcggtcttct tggaggagtg       420
     ggagcgaaag aacgccgaga aaaaatcgga aatatactaa aaattggtta tacaaacgga       480
     aaacaactac aaaccagact agaatcattt gcaatcagtg aagaacagtt agtagccgcg       540
     tgccaaaaga ttatgcagga ggaagaaaat gagtaa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page