(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0189

AL591973.LMO0189     Location/Qualifiers
FT   CDS_pept        193593..193850
FT                   /transl_table=11
FT                   /gene="lmo0189"
FT                   /note="highly similar to B. subtilis Veg protein"
FT                   /db_xref="GOA:Q92F78"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:Q92F78"
FT                   /protein_id="CAC98404.1"
FT                   /translation="MPKTIASIKTNLDSRLGKALTLKANGGRKKTIERCGILAETYPSV
FT                   FIVELDQDENNFERVSYSYTDILTDAVELVFTDDNKELAL"
     atgccaaaaa ccattgcaag cattaagacg aatttagatt ctagattagg taaagcattg        60
     acattgaaag caaacggtgg tcgtaagaaa acgattgaac gttgcggtat cctagctgaa       120
     acatatccat ccgttttcat tgtggagctt gatcaagatg aaaacaactt tgaaagagta       180
     tcctatagtt acacggatat cttaacagac gcagtagaac ttgtatttac agatgataat       240
     aaagaattag ctttataa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page