(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0194

AL591973.LMO0194     Location/Qualifiers
FT   CDS_pept        197512..198204
FT                   /transl_table=11
FT                   /gene="lmo0194"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="GOA:Q8YAD7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAD7"
FT                   /protein_id="CAC98409.1"
FT                   /translation="MPKPLIDMKNLTKTYTLGGETFKALDDVTFTVEQGEFLSIVGPSG
FT                   SGKSTLMNMIGCLDVPDEGSYHLDDVDVFKLSDNKLSEIRNKKIGFIFQQFNLLPKLSA
FT                   FENVELPLIYAGLSVSAREKAAIECLEKVGLLEKRRNLPTQLSGGQQQRVAIARALAGK
FT                   PQILLADEPTGALDSKTGKEVMGILQELNRAGNTIVMITHDPTIASYGTRSIRIQDGKL
FT                   FHEEATQA"
     atgccaaaac cgctaattga catgaaaaat ttaacgaaaa catatacgct aggcggagaa        60
     acttttaaag cattagacga tgttactttt accgttgagc aaggcgagtt tttatccatc       120
     gttggtccgt ccggttccgg taaatctact ttaatgaata tgattggctg tttggacgtt       180
     ccggatgaag gcagctatca ccttgatgat gtagatgttt ttaaactgag cgataataaa       240
     ctatccgaaa tcagaaataa aaaaatcggc tttatttttc agcagtttaa tttgcttcca       300
     aaattatctg cctttgaaaa cgtggaacta ccactaattt atgcaggact aagtgtttct       360
     gcacgagaaa aagccgcaat cgaatgtttg gaaaaagtag gcttacttga aaagcgtaga       420
     aacttaccaa cgcaactttc tggtggacag cagcaacgtg ttgctatcgc tagagcactt       480
     gctggtaaac cgcaaatttt gctagcagat gagccaactg gtgcgcttga ttcgaaaact       540
     ggtaaagaag taatggggat cctgcaagaa ttgaatcgcg ctggaaacac cattgttatg       600
     attacacatg atccaactat cgcctcttac ggtacaagaa gtatccgtat tcaagatggt       660
     aaattattcc atgaggaggc gacccaagca tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page