(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0195

AL591973.LMO0195     Location/Qualifiers
FT   CDS_pept        198201..199409
FT                   /transl_table=11
FT                   /gene="lmo0195"
FT                   /note="similar to membrane protein (putative ABC
FT                   transporter component)"
FT                   /db_xref="GOA:Q8YAD6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAD6"
FT                   /protein_id="CAC98410.1"
FT                   /translation="MNVLQSMKMAWKQLKASKLRSFLTMLGIIIGVASVILLVSLGNGV
FT                   TQEVDDQMGDLGSNLITVVNSSVNPNDKYTYDEVMKYQNIDGVKSVSPELSGQVNATFD
FT                   YKNSSNKVIGTNDQYKAARSLEMKEGRFLLPIDTEYGQKVAVIGSTVASDLFGFGDPIG
FT                   ETIRLNGMPYKVVGVLKEKGASMMGSSDDQIFIPISSAQRLLKDTNVRTIYVETKSAED
FT                   VDFVVNTLESRLAIKFGDEKEQEKNASSAQMGPSYQVINQQEILNAFNTISTTLTTALG
FT                   AIAAISLVVGGIGIMNIMLVSVSERTREIGIRKALGAKKRAILLQFLIESIVISVCGGV
FT                   IGIIIGVSGALIFGSVAGISSGITAGTIIFSFVFSLCIGVIFGIAPANKASKLRPIDAL
FT                   RSE"
     atgaacgttc tccaaagtat gaaaatggca tggaaacaat taaaggcaag taaattaagg        60
     tcttttctaa ccatgctagg tattattatt ggtgtcgcat ctgttattct tttagtatct       120
     cttggaaatg gtgtgacgca agaagttgat gatcaaatgg gcgatttggg ttcgaattta       180
     attacagtag ttaatagctc tgttaatcca aacgacaaat atacgtatga tgaagtaatg       240
     aaatatcaaa acattgatgg agtcaaaagc gtttctccag aattatctgg acaagtcaat       300
     gcaacttttg attataagaa ttcaagtaat aaggtgatag gcacgaatga ccaatataag       360
     gccgcgcgta gcctagaaat gaaagaaggg cgtttcctac taccgattga taccgaatat       420
     ggccagaaag tagctgtaat aggctctacg gtagcaagtg atctatttgg ttttggggat       480
     ccgattggcg aaaccattag attaaacgga atgccttaca aagttgttgg tgtcttgaaa       540
     gaaaaaggcg cgtctatgat gggatcgagc gatgatcaaa tctttattcc gatttcttcc       600
     gctcaaaggc tcttaaaaga tacgaacgtt cgtacaattt atgtagaaac aaaatctgct       660
     gaagatgttg attttgtagt aaacacatta gaatcacgtc ttgcaattaa atttggcgac       720
     gaaaaagaac aagaaaaaaa tgcttcatct gcacaaatgg gaccatctta tcaagtcatc       780
     aatcaacaag agattctcaa tgctttcaac acgattagta caaccctaac tactgcgctt       840
     ggtgcgattg ctgccatttc gcttgttgtt ggtggtattg gaattatgaa tattatgcta       900
     gtttctgtta gtgagcgaac gagagagatt ggtataagaa aagcgctcgg agctaaaaaa       960
     cgggccattc tgttacaatt cctaattgaa tccattgtta ttagtgtctg tggtggggtt      1020
     atcggtatta ttatcggtgt ctcaggagcg ctcatatttg gctccgtcgc aggtatatcg      1080
     tcaggaataa ctgcaggaac cattatattc tccttcgtat tctcactatg tattggagtg      1140
     atatttggta tcgcacctgc taataaagct tcgaaattaa gaccaattga cgcattaaga      1200
     tccgagtaa                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page