(data stored in SCRATCH3701 zone)

EMBL: AL591973.QOXC

AL591973.QOXC        Location/Qualifiers
FT   CDS_pept        19311..19922
FT                   /transl_table=11
FT                   /gene="qoxC"
FT                   /product="AA3-600 quinol oxidase subunit III"
FT                   /db_xref="GOA:Q8YAU8"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014246"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAU8"
FT                   /protein_id="CAC98230.1"
FT                   /translation="MESVETNKNLPIEYRSEQGRLNILGFWIFLGAEIALFATLFATYF
FT                   VMRKAGSNAGHPPAEMFELWLVLIMTFLLLTSSFTCGLAIGEMRKGNVKMLTIYSIITL
FT                   ILGAGFVGFELYEFAHYVTEGVTMQVGSYWSAFFVLLGTHGLHVTVGIFWISFILIQIK
FT                   MHGLTPKTASKVFISSLYWHFLDVVWIFIFTGVYLLGMVN"
     atggaatctg tagaaacaaa taaaaatctg ccaattgaat atagatcaga acaaggtcga        60
     ttaaatattc ttggattctg gattttcctt ggcgccgaaa ttgcattgtt tgcaacgctt       120
     tttgcgactt actttgttat gaggaaggct ggctcgaatg cggggcatcc gccagcagaa       180
     atgttcgaac tttggctagt gctaataatg acatttttac ttttaacaag tagttttacg       240
     tgtggtctag caattggtga aatgcgtaaa ggcaatgtga aaatgttgac gatttactcg       300
     attatcacat taattcttgg tgcgggattt gttggctttg agctttatga atttgcacac       360
     tatgtgacag aaggagttac gatgcaagtt ggttcttact ggtcggcatt cttcgttcta       420
     ctaggaacac atggacttca cgtaacggtc gggattttct ggattagttt tattctgatt       480
     caaattaaaa tgcatggttt gacgccaaaa acagcatcaa aagtatttat ttccagttta       540
     tactggcatt tcttggatgt tgtgtggatt ttcattttca ccggtgtcta tttgctaggg       600
     atggtgaact aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page