(data stored in SCRATCH3701 zone)

EMBL: AL591973.RPLI

AL591973.RPLI        Location/Qualifiers
FT   CDS_pept        56815..57261
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="GOA:Q8YAR2"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAR2"
FT                   /protein_id="CAC98268.1"
FT                   /translation="MKVIFLKDVKGKGKKGETKNVADGYANNFLIKNGYAVEANNAALS
FT                   TLSAQKKKEDKLAAEELAEAKALKEKMENLTVELKAKSGEGGRLFGSITSKQIAQTLEK
FT                   THGIKIDKRKMDLPEAIRALGHTKVPVKLHHEVTATLDVHVSEE"
     atgaaagtta ttttcttgaa agacgtaaaa ggtaaaggta aaaaaggtga aactaaaaat        60
     gttgctgatg gttatgcaaa caatttttta attaaaaatg gttacgcagt tgaggctaac       120
     aatgcggctt taagcactct ttcagcgcaa aagaaaaaag aagataaatt agctgctgaa       180
     gaactagctg aagcaaaagc tttgaaagaa aaaatggaaa atttaacagt ggaattaaaa       240
     gcgaagtctg gtgaaggcgg cagattgttt ggttctatta catctaaaca aattgctcaa       300
     acgcttgaaa aaacacatgg tattaaaata gacaaacgta aaatggactt accagaagcg       360
     attcgagctt taggacatac gaaggtgccg gtgaagttgc accatgaagt aacggcaaca       420
     cttgatgtac atgttagtga agaataa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page