(data stored in SCRATCH3701 zone)

EMBL: AL591973.RPSF

AL591973.RPSF        Location/Qualifiers
FT   CDS_pept        49585..49878
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /product="ribosomal protein S6"
FT                   /db_xref="GOA:Q8YAR9"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAR9"
FT                   /protein_id="CAC98259.1"
FT                   /translation="MARKYEIMYIIRPNIEEDEKKAVVERFDGILTENGAEIIESKEWG
FT                   KRRLAYEINDYRDGFYHIVKLNADKADSINEFDRLAKISDDIIRHMVIKEEA"
     atggctagaa agtacgaaat tatgtacatc attcgcccaa acattgaaga agatgagaaa        60
     aaagctgttg tagaacgctt tgacggaatc ttaactgaaa atggtgcgga gatcatcgaa       120
     tcaaaagaat ggggtaaacg tcgcttagca tacgaaatca atgactatcg tgatggtttt       180
     taccacatcg tgaaattaaa cgctgataaa gcagattcta tcaacgaatt tgaccgttta       240
     gctaaaattt ctgatgatat cattcgtcat atggtaatta aagaagaagc ataa             294
//

If you have problems or comments...

PBIL Back to PBIL home page