(data stored in SCRATCH3701 zone)

EMBL: AL591973.RPSR

AL591973.RPSR        Location/Qualifiers
FT   CDS_pept        50514..50753
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /product="ribosomal protein S18"
FT                   /db_xref="GOA:P66461"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66461"
FT                   /protein_id="CAC98261.1"
FT                   /translation="MAGGRRGGRRRKKVCYFTSNGITHIDYKDVELLKKFVSERGKILP
FT                   RRVTGTSAKYQRKLTVAIKRSRQMALLPFVAEEK"
     atggctggag gacgcagagg cggacgccgt cggaaaaaag tatgttactt tacttccaat        60
     ggtattacgc atatcgacta taaagatgta gaacttctta aaaaattcgt ttccgaacgt       120
     ggtaaaattt tacctcgtcg tgtaactgga acaagcgcta aatatcaacg taaacttact       180
     gttgctatca aacgctcacg ccaaatggca ttactaccat ttgttgctga agaaaaataa       240
//

If you have problems or comments...

PBIL Back to PBIL home page