(data stored in SCRATCH3701 zone)

EMBL: AL591973.SSB

AL591973.SSB         Location/Qualifiers
FT   CDS_pept        49934..50470
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /note="highly similar to single-strand binding protein
FT                   (SSB)"
FT                   /db_xref="GOA:Q8YAR8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAR8"
FT                   /protein_id="CAC98260.1"
FT                   /translation="MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGERE
FT                   ADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEGNDGKRVYVTEIVAESVQFLE
FT                   PRNSNGGGGNNYQSGNNNNNYNSGGNNFGQAPTNNGGFGQDQQQSQNQNYQSTNNDPFA
FT                   SDGKPIDISDDDLPF"
     atgatgaatc gtgtagtact tgtaggacgc ttaacaaaag atcctgaatt acgttacact        60
     ccagctggtg tggctgttgc gacttttaca ttagctgtaa atcgcacttt cactaaccaa       120
     caaggagaac gagaagctga ctttattaat tgtgttgttt ggcgtaaacc ggcagaaaac       180
     gttgctaatt tcctgaagaa gggaagcatg gcgggcgttg atggccgtgt tcaaactcgt       240
     aattacgagg gaaacgacgg taaacgtgtt tatgtgactg aaattgtagc agagagtgtt       300
     caattccttg aaccgcgtaa ttctaatggc ggtggcggaa ataactatca aagtggcaat       360
     aacaacaata attacaatag cggtggaaat aacttcggac aagcacctac aaataacggt       420
     ggattcggac aggaccagca acaatctcaa aatcaaaatt atcaatccac taataatgat       480
     ccttttgcaa gtgatggtaa gccaatcgac atttctgatg acgatttgcc attctaa          537
//

If you have problems or comments...

PBIL Back to PBIL home page