(data stored in ACNUC9435 zone)

EMBL: AL596167.ACKA2

AL596167.ACKA2       Location/Qualifiers
FT   CDS_pept        182511..183704
FT                   /transl_table=11
FT                   /gene="AckA2"
FT                   /note="similar to acetate kinase"
FT                   /db_xref="GOA:Q92CN9"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CN9"
FT                   /protein_id="CAC96363.1"
FT                   /translation="MHKIMAINAGSSSLKFQIFTMPGEEVLVKGLIERIGLPDAIFNMS
FT                   FQNEKIKETRAINNHGEAVEILLEQLKTHQVINDLNEITGVGHRVAHGGEAFVSSCIVT
FT                   DDVVKGIEDVTSLAPLHNPANIIGIKTFRELLPNAVSVAVFDTAFHQTIPEENFLYALP
FT                   YELYEKHHIRKYGFHGTSHKYVAGKAAEVLKKPLEKLKIISCHLGNGASVCAIEAGKSV
FT                   NTSMGFTPNAGLMMGTRSGTIDATIIPYLVDELGYSLDEVTHMMSSESGVLGVSGISSD
FT                   FRDIEIAANEGNSRALLTLRMFTGQICNYIGAYASAMNGCDALLFTAGVGENSPLIRKM
FT                   VTEQLSYLGVTCNVTKNNAGDMIISNDDEAVKVCIIPTNEELMIARDVEKYTKQTIS"
     atgcacaaaa ttatggcgat aaacgcaggg agttcttcac tgaaattcca aatttttacg        60
     atgccaggag aagaagtctt agttaagggc ttaattgaaa gaatcggctt accagatgcc       120
     atattcaaca tgtcctttca aaatgaaaaa atcaaggaaa ctcgcgcgat aaataatcac       180
     ggagaagcag tggaaattct actggagcaa ttgaagacgc atcaagtaat taatgaccta       240
     aatgaaatta caggagtggg acatcgggtt gcgcacggcg gagaagcttt tgtttcttca       300
     tgtattgtaa cggatgatgt tgtaaagggg attgaagatg taacaagtct tgcgccgctt       360
     cataatccag ccaatatcat cggcattaaa acattccgcg aactattacc aaatgccgtt       420
     tcggttgcag tgtttgatac ggccttccat caaacgattc cagaagaaaa ctttttatat       480
     gcgctccctt atgaacttta tgaaaaacat catattcgaa aatacggttt tcatggaaca       540
     agccataaat atgtggctgg aaaagcagca gaagttctca agaaaccttt agaaaaatta       600
     aaaattattt cttgtcattt aggaaatggg gcgagtgttt gtgcgattga agcagggaaa       660
     tcagtgaata cttccatggg ctttacacca aatgctggct tgatgatggg aacacgttct       720
     ggtacaattg acgcgacaat catcccttat ttagttgacg aattaggcta tagcttggat       780
     gaagtgacac atatgatgtc tagtgaatct ggcgttcttg gtgtatccgg aatttctagt       840
     gattttagag acatcgaaat tgctgcgaat gaaggaaatt cgcgtgcatt attaacactt       900
     cggatgttta ctggccaaat ctgtaattat atcggggctt acgcttctgc catgaatggt       960
     tgtgatgcat tattatttac ggctggagtt ggtgaaaatt caccattaat tcgtaaaatg      1020
     gttacagaac agctgagtta tcttggtgta acatgtaatg tgacaaaaaa taatgcaggt      1080
     gatatgataa ttagcaatga tgacgaagcg gtcaaagtat gcattattcc aacaaacgaa      1140
     gaactaatga ttgctcgaga tgtagaaaaa tatacaaaac aaacgataag ttaa            1194
//

If you have problems or comments...

PBIL Back to PBIL home page