(data stored in ACNUC9435 zone)

EMBL: AL596167.CBID

AL596167.CBID        Location/Qualifiers
FT   CDS_pept        205726..206847
FT                   /transl_table=11
FT                   /gene="cbiD"
FT                   /note="similar to cobalamin biosynthesis protein  CbiD"
FT                   /db_xref="GOA:Q92CL4"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CL4"
FT                   /protein_id="CAC96388.1"
FT                   /translation="MEDFIYYNGKKYRKGYTTGTCAAAAAKACVEMIENQEEVSAVKVT
FT                   TTGGTILEIPVAYQQFSEKKATAAVQKDGGDDIDATHGMWIFVDVELTDSPEVTLDGGV
FT                   GIGRATQKGISVEVGEAAINPAPRKNILATVRESLGENRGATILVYAPEGEERAKRTMN
FT                   SNLGIIGGISILGTTGIVTPMSDEGWKKSLSMELEMKRNQGLDQIILVPGNYGDDFVQN
FT                   TLGFASDNIVSMSNFVGYMLKETQRLAFKKVLMVGHFGKLVKVSAGIFTTYSKDADARA
FT                   EILVANLALLGAPLSLLQEVEKCNTTEAAGELIEAAGFTQVYEVIAQKIKARSERFLKF
FT                   TKPSVEIDVVTFSTERGLLAATKDIEVLREEWR"
     gtggaagatt ttatttatta taatggcaaa aaatatcgta aaggctatac aactggaacg        60
     tgtgcagctg ccgcggctaa agcgtgtgtc gaaatgatag aaaaccaaga agaagtaagc       120
     gcggttaaag tcacaacaac aggtggaact attcttgaaa tccccgttgc ctatcaacag       180
     ttttctgaaa aaaaggcaac tgcagctgtt caaaaagatg gcggggatga tattgatgcc       240
     acacacggca tgtggatttt tgttgatgtc gaattaacag atagtccgga agttacttta       300
     gatggaggcg ttggaattgg tcgcgcaaca caaaagggta tttcggttga agtgggtgaa       360
     gcggcaatta atccggcacc aaggaaaaat attttagcta cagtacgcga atcacttggc       420
     gaaaatcgtg gcgcaaccat tttagtatat gctcctgaag gggaagaacg cgcgaaacga       480
     acaatgaata gcaacctcgg tattatcggc gggatttcca ttttaggaac gacaggtatt       540
     gtcacaccga tgtcggatga aggctggaaa aaatcattat caatggagct cgaaatgaaa       600
     cggaaccaag gacttgacca aattattctt gttccaggta attacggcga tgattttgtt       660
     caaaatacgc ttggttttgc gagtgataac atcgtttcca tgagtaattt cgttggttac       720
     atgttgaaag aaacccaacg actcgcattt aagaaagtat tgatggttgg gcattttggc       780
     aaattagtga aggtttcagc tggtattttt acgacctata gcaaggatgc ggatgcgcgg       840
     gcagaaatct tggtggctaa cttggcttta ctcggcgcac cattatcact tttacaagaa       900
     gtagagaagt gtaatacgac agaggctgca ggcgaattaa ttgaagcagc tggttttact       960
     caagtttatg aggtaatcgc acaaaaaatc aaagcaaggt cagaacgctt cttgaaattc      1020
     actaagccaa gtgtggaaat tgatgtcgtt acattttcaa ctgaaagagg cttacttgct      1080
     gcaacgaaag acatagaagt attgcgggag gaatggcgat ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page