(data stored in ACNUC9435 zone)

EMBL: AL596167.CBIG

AL596167.CBIG        Location/Qualifiers
FT   CDS_pept        208741..209772
FT                   /transl_table=11
FT                   /gene="cbiG"
FT                   /note="similar to cobalamin biosynthesis protein G CbiG"
FT                   /db_xref="GOA:Q92CL0"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CL0"
FT                   /protein_id="CAC96392.1"
FT                   /translation="MNTDKIAIIAVTERGRDLAISLTKTLPGTVFVPEKHQNEQTAVLT
FT                   PNFGTAMREMFTTHQALICIMATGIAVRTLAPVIQDKLSDPAVIVMDEYGQFIISLLSG
FT                   HVGGANELTEQIAAITGGAAVITTATDRANVAAIDNIAKEIDGYLPDFKATTKRINGLL
FT                   AAGKEVSLHVDEPFEVDSRGFTNKEISPQIFISTKYNLPDTKIERIQLVPRKFVLGIGC
FT                   RKGVSAETMEEVFTHFCEQENIHPRAFREIHSITLKAEEPAILQLAKKWNIHFIVHSAE
FT                   ELQTVAEKYPTSEFVLKTVKVGNVALSSADIGSNGNVITKRFAENGVTFAAGKLIKNNE
FT                   VAK"
     atgaatacag ataaaattgc cattatcgca gttactgaac gagggcgcga tttagcaatt        60
     tcattaacaa aaacattacc aggaacggtc tttgtcccag aaaagcacca gaatgaacag       120
     actgcagttt taacgcctaa ttttggtaca gcaatgcgtg aaatgttcac gacgcatcag       180
     gcattaattt gtattatggc aacaggtatt gcggtgcgga cgcttgctcc agtcattcaa       240
     gataaactat cggatccggc agtaattgta atggatgaat atggtcagtt tattattagt       300
     ttactctcag gacatgttgg aggagcaaat gagttaacgg agcaaattgc tgcaattact       360
     ggtggtgccg cagtaattac aaccgctact gatcgtgcaa atgtggcagc aattgataat       420
     atcgccaaag aaatcgacgg atatttaccc gattttaaag cgacgactaa acgcattaat       480
     ggcttgctcg ctgctggaaa agaagtcagt ttgcacgtag atgagccatt tgaagtagat       540
     tcacgaggtt ttacaaacaa agaaattagt ccacaaattt tcatttcgac caaatacaat       600
     ttaccagata caaaaataga aagaattcag ctagtaccaa ggaagttcgt gcttggtatt       660
     ggatgtcgaa aaggcgtttc agcggaaaca atggaggaag ttttcaccca tttttgtgaa       720
     caagaaaaca tacatccgcg cgcttttcgt gaaatccata gcattacatt gaaagcagaa       780
     gaaccagcca ttttgcaatt agcgaaaaag tggaacattc attttattgt tcattccgca       840
     gaagaattac aaacggtagc tgaaaaatat ccaacgtcag aatttgttct aaaaaccgta       900
     aaagttggaa atgtcgcttt atcatcagca gatattggta gtaatggaaa cgtcattacg       960
     aaacgatttg ccgaaaatgg cgtgacattc gcagcaggaa aactaattaa aaataatgag      1020
     gtggcaaaat ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page