(data stored in ACNUC9435 zone)

EMBL: AL596167.CBIQ

AL596167.CBIQ        Location/Qualifiers
FT   CDS_pept        215220..215897
FT                   /transl_table=11
FT                   /gene="cbiQ"
FT                   /note="similar to cobalt transport protein Q"
FT                   /db_xref="GOA:Q92CK2"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CK2"
FT                   /protein_id="CAC96400.1"
FT                   /translation="MLTIDKYAYQNRWIAFSPSLKALFYVAILILALTGPVLVQAILFL
FT                   CMVPLTLYVVKIHFKQYLKWLLLPFSFLLFSLLSILISISKDPSSFLASISIGSFYLGI
FT                   SDVTITTATQVFFRSIACLAATYFFVLTVPVVQLTKVMKQIFIPKVLIELTILIYRFIF
FT                   IFLEEAAAIRKAQSLRFGYHGIKNSYRSFGMLVNTLFNRVMKRYNEMVITLDVKLYQGE
FT                   FHI"
     atgttaacca ttgataaata tgcttatcaa aaccggtgga tagctttttc gccatcatta        60
     aaagcattat tttatgtcgc gattctaata ctcgcgctaa ctggccctgt gctcgtacaa       120
     gcgatactat ttttatgcat ggtgccactg acgctttatg ttgttaaaat ccactttaaa       180
     caatatttga aatggctcct tttaccattt tcatttctac tatttagttt gctttcgatt       240
     cttatttcaa tttcaaaaga tccaagtagt tttcttgctt caatctctat tggaagtttt       300
     tatcttggta tttctgatgt gacgataacg acagcaactc aagttttttt tcggagtatt       360
     gcttgcttag cggcaacata ctttttcgtc ttaaccgttc ccgtggtaca attaacgaaa       420
     gtgatgaagc aaatttttat tccaaaagtg cttattgaac taacgatttt aatttatcgg       480
     ttcatcttta ttttcttaga agaagcggcg gcgattcgaa aagcgcagag cctacgtttc       540
     ggttaccacg gcataaaaaa tagctatcgt tcatttggaa tgctcgtaaa tactttattt       600
     aatcgcgtaa tgaaaagata taatgaaatg gttataacac ttgatgtgaa gctatatcaa       660
     ggagaatttc atatctag                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page