(data stored in ACNUC9435 zone)

EMBL: AL596167.COBD

AL596167.COBD        Location/Qualifiers
FT   CDS_pept        183718..184803
FT                   /transl_table=11
FT                   /gene="cobD"
FT                   /note="similar to Salmonella typhimurium CobD protein and
FT                   to histidinol-phosphate aminotransferase"
FT                   /db_xref="GOA:Q92CN8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005860"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CN8"
FT                   /protein_id="CAC96364.1"
FT                   /translation="MKITTAMHGGNYNELAKQHGLTKEMILDFSANINPLGVPASLKQT
FT                   ITANLDKLVEYPEPDYLALRARIASFHQLDLANVIPGNGATELIFGIAKVTKAQKVLLL
FT                   APTFAEYERAFFDAEIIYAELTKETHFAAAETVLEMIKRETDLEAVCLCNPNNPTGQLI
FT                   SQQEMIQIAELCEERNIYLIIDEAFMDFLEGNETISMINYLGSFPHLAIIRAFTKFFAI
FT                   PGLRLGYLLTKNDLLAEALLQMREPWSINTFADMAGQVLLDDTDYITQTYNWISAERDF
FT                   LYQELSKFSELTVYRPSVNYIFFHLETPLDLRKELLLKGIFIRSCANYRGLTENYYRVA
FT                   VKARCDNTKLIRALEVIFSGN"
     gtgaaaataa cgacggcaat gcacggtggc aactataacg aactagcaaa acaacatgga        60
     ttaaccaaag aaatgattct ggattttagt gcgaatatta atccacttgg cgttccagct       120
     agtttgaaac aaacgataac agcgaatttg gataaactgg tggaatatcc agaaccagat       180
     tacttagcgc tccgtgcgcg tattgcctcg tttcatcaac ttgacttagc aaatgttatt       240
     ccaggaaacg gtgctactga gctgattttc ggaatcgcaa aagtaaccaa ggcgcaaaaa       300
     gttctcttac ttgcgcctac ttttgcggaa tatgaacggg ctttttttga tgcggaaatt       360
     atttatgcag aattaacgaa agaaactcat tttgctgcag cggaaacggt actagaaatg       420
     attaaacgcg aaacagatct tgaagcggtt tgtttgtgca acccgaataa tccaaccgga       480
     caattaatat cgcagcaaga aatgatccaa attgcagaat tatgtgaaga acgaaacata       540
     tatttaatca ttgatgaggc gtttatggat tttttagaag gcaacgaaac aatttcgatg       600
     attaattatt tagggagctt tccacattta gcaattatcc gggcattcac aaaatttttt       660
     gcaattccag ggctaagact tggttatttg ttgaccaaaa atgatttgct agctgaagca       720
     ttattacaaa tgcgtgaacc ttggtctatc aatacttttg ccgatatggc tggtcaagta       780
     ttactagatg atacagacta catcactcaa acatacaact ggatttcagc tgaacgagat       840
     tttttatatc aagagttgtc taagtttagc gaactaaccg tgtatcgccc aagtgtaaac       900
     tacatatttt tccatcttga aacaccgctt gacttacgaa aagaattatt gttaaaaggg       960
     atttttatac ggagttgcgc caattaccgt ggactcactg aaaattatta ccgagttgcg      1020
     gtgaaagcta gatgtgataa taccaagctt ataagagcgc tcgaggtgat ttttagtgga      1080
     aattaa                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page