(data stored in ACNUC9435 zone)

EMBL: AL596167.DLTA

AL596167.DLTA        Location/Qualifiers
FT   CDS_pept        complement(31637..33169)
FT                   /transl_table=11
FT                   /gene="dltA"
FT                   /product="D-alanine-activating enzyme (dae),
FT                   D-alanine-D-alanyl carrier protein ligase (dcl)"
FT                   /db_xref="GOA:Q92D47"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010072"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D47"
FT                   /protein_id="CAC96204.1"
FT                   /translation="MTTSIIERIDAWAEKTPDFPCYEYAGTRLSYKELKRQSDAFGSFL
FT                   LNTLNSDKEKPIIVYGHMSPLMLIAFLGTIKSGRAYVPVDVSMPVERIEQIKKAADPAL
FT                   FICTEELPSNLTITGCPVLTQDQLMDALEKHFEEVPDPAECVKNDDNYYIIYTSGSTGN
FT                   PKGVQISQNNLVSFSNWILQDFSLRQGLRFLNQAPFSFDLSVMDLYPSLLSGGTLVPLD
FT                   KTITANMKDLYREIPAQNFDVWVSTPSFADLCLLDDNFNQENNPNLTRFLFCGEVLAKK
FT                   TASELLDRFPDAVIYNTYGPTEATVAVTQVKVTRELIDAYPSLPLGVIKPDMRLHIVDQ
FT                   ETGEILPEGEKGEIILIGASVSKGYLNEPEKTDQVFFDYKGYQAYHTGDSGVIKDGYLF
FT                   FQGRLDFQIKLHGYRIELEDIENNLKKVSYIQNCAIIPKMKDEKVDMLVAQVIPSSHDF
FT                   EKEYQLSAAIKNELKEFMPAYMIPRKWIYKTEFPLTMNGKIDRKALNSEVNK"
     atgacaacga gtatcattga aagaattgat gcatgggcag aaaagacacc ggatttccct        60
     tgctatgaat atgctggaac acgtctttcc tacaaagaac ttaaacggca atcggatgca       120
     ttcggctctt ttctactaaa tactttaaac tctgacaaag aaaaacctat tatcgtgtac       180
     ggacacatgt ccccactaat gcttattgcg tttttaggta ctattaaatc aggacgtgct       240
     tatgttcctg tagatgtttc tatgccagtt gaacgtatag aacaaatcaa aaaagcagca       300
     gatcctgcac tattcatttg cacagaagag cttccaagca accttacaat tacaggttgt       360
     cccgttctaa cacaagacca attgatggat gctttggaaa aacattttga agaagtgcca       420
     gaccctgctg aatgtgttaa aaatgatgat aattattata ttatatacac atcaggaagc       480
     acaggaaatc caaaaggcgt tcaaattagc caaaacaatt tagttagttt tagcaattgg       540
     attttacaag atttctcgtt aagacaagga ttgcgcttct taaaccaagc accattttcc       600
     tttgacttgt cggttatgga cttatatcca agcttacttt caggcggaac tcttgtacca       660
     ctagataaaa caatcactgc taatatgaaa gatttatatc gcgaaatacc tgctcaaaat       720
     tttgatgtat gggtttctac tccatcattt gcagacttat gtttactaga tgataatttc       780
     aaccaagaaa acaaccctaa tttaacacgt ttcttattct gtggtgaagt acttgctaag       840
     aaaacagcaa gtgaactact tgaccgtttc ccagatgcag tcatttataa cacatacggg       900
     ccgactgaag ctactgttgc tgttacacaa gtaaaagtaa cacgcgagtt gattgatgct       960
     tatccgagcc taccacttgg agttattaaa ccagatatgc gacttcatat tgtcgatcaa      1020
     gaaactggtg aaatacttcc tgaaggcgaa aaaggcgaaa tcatcctaat cggtgcaagt      1080
     gtttcaaaag gatatttaaa cgaaccagaa aaaacagacc aagtattctt tgattacaaa      1140
     ggttaccaag cctaccatac tggtgactct ggtgttataa aagatggtta tctcttcttc      1200
     caaggtcgtc ttgacttcca aattaagctt catggttaca gaatcgaact tgaagatatt      1260
     gaaaacaatc taaaaaaagt aagttacatc caaaactgcg ctattattcc taaaatgaaa      1320
     gatgaaaagg ttgatatgtt ggtcgctcag gtcatcccgt cttcccacga ttttgaaaaa      1380
     gaataccagc taagtgcagc aatcaaaaac gaattaaaag aatttatgcc agcatatatg      1440
     atcccaagaa aatggattta taaaacggaa ttcccgttga caatgaatgg caaaattgat      1500
     cgaaaagcac ttaacagcga ggttaacaag tga                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page