(data stored in ACNUC9435 zone)

EMBL: AL596167.DLTB

AL596167.DLTB        Location/Qualifiers
FT   CDS_pept        complement(30456..31640)
FT                   /transl_table=11
FT                   /gene="dltB"
FT                   /product="DltB protein for D-alanine esterification of
FT                   lipoteichoic acid and wall teichoic acid"
FT                   /db_xref="GOA:Q92D48"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024024"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D48"
FT                   /protein_id="CAC96203.1"
FT                   /translation="MSTPYGTILYFGVLLLFFIPIIVAGLLGKRLPIYNAFVTLVFLYF
FT                   LFAANPVQGVTFIFFVFWQLALVRLYFHYRQEKKQNHGGVFVIAVILSILPLVISKVVP
FT                   ILGDQVTMVGFLGISYLTFKATQMIIEIRDNLIKQYNAWDFVNFLLFFPTISSGPIDRF
FT                   RRFKKDVDNPPSKEAYVALLNRGIFLIFLGFLYKFIIAYLVNKHFVVPLDIAITHNVDT
FT                   TTSLIGYMYAYSMYLFFDFAGYSAFAVGVSYLLGVQTPMNFNKPFAARNIKEFWNRWHM
FT                   TLSFWFRDYVFMRFVLWLTKKKWFKSKFTIAYIAYFVNFFIMGVWHGLHWYYIVYGLYQ
FT                   ATLIVGFDLIERFNKKHKFYPKNKITYVIGVIITFQFVCFGFLIFSGILDKINF"
     gtgagcacac catacggtac aatactttat tttggagtac ttcttctgtt tttcattcct        60
     atcatagtag ctggtttgtt aggaaaaaga ttaccgatat ataacgcttt tgtcacatta       120
     gtatttttat actttttatt cgctgcaaat ccagtccaag gagttacttt tatcttcttt       180
     gttttctggc aacttgcact cgtacgactt tacttccatt acaggcagga gaaaaaacag       240
     aatcatggcg gcgtattcgt catagcagtg attctctcca ttctcccgct tgtaatctct       300
     aaagtagttc caattttagg agaccaagta acaatggttg gtttcctagg gatttcgtac       360
     ttaactttta aagcgacaca aatgattatt gaaatacgcg ataacttaat taaacagtac       420
     aacgcatggg attttgttaa tttcttacta tttttcccaa ctatttcatc aggaccgatt       480
     gaccggttcc gtcgctttaa aaaagacgtt gataatccgc ctagtaaaga agcttatgtt       540
     gctttactga atcgaggaat tttccttatc ttccttggtt ttctctataa attcattatc       600
     gcatacttag taaacaaaca ttttgttgtt ccactagaca tcgcgattac acacaatgtt       660
     gatacaacaa caagtttgat tggttatatg tacgcataca gtatgtactt attctttgac       720
     tttgctggct acagtgcctt cgcagtcgga gtgagttatc tactcggcgt tcaaacacca       780
     atgaacttca ataagccttt tgcagcacga aacattaaag aattctggaa tcgctggcat       840
     atgactcttt ccttctggtt ccgtgattat gtatttatgc gttttgtctt atggcttaca       900
     aaaaagaaat ggttcaagag taagttcacc atcgcctata tcgcatattt tgttaacttt       960
     ttcattatgg gtgtatggca cggacttcac tggtattaca tcgtttatgg tctttatcaa      1020
     gccactttaa ttgttggttt cgacctaatc gaacgcttta acaaaaagca caagttctat      1080
     ccaaaaaaca aaataactta tgtaatcggc gttatcatta cattccaatt tgtttgtttc      1140
     ggattcctga ttttctcagg tattttagat aaaattaatt tttaa                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page