(data stored in ACNUC9435 zone)

EMBL: AL596167.DLTC

AL596167.DLTC        Location/Qualifiers
FT   CDS_pept        complement(30195..30431)
FT                   /transl_table=11
FT                   /gene="dltC"
FT                   /product="D-alanyl carrier protein"
FT                   /db_xref="GOA:Q92D49"
FT                   /db_xref="InterPro:IPR003230"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D49"
FT                   /protein_id="CAC96202.1"
FT                   /translation="MAFRENVLEILEEITETDEVVQNTNIKLFDEGLLDSMATVQLLIE
FT                   IESRLDITVPVSEFDRDEWATPEMIITQLEALK"
     atggcttttc gtgaaaatgt attagaaatc ttagaagaaa ttacagaaac tgatgaagta        60
     gtacaaaata caaatatcaa attatttgat gaaggtttac tagactcaat ggcaactgtt       120
     caacttttaa ttgaaattga atcaagacta gatattactg tacccgtttc agaatttgac       180
     cgcgacgaat gggctactcc tgaaatgatt attacacaac ttgaggcgct aaaataa          237
//

If you have problems or comments...

PBIL Back to PBIL home page