(data stored in ACNUC9435 zone)

EMBL: AL596167.DLTD

AL596167.DLTD        Location/Qualifiers
FT   CDS_pept        complement(28921..30195)
FT                   /transl_table=11
FT                   /gene="dltD"
FT                   /product="DltD protein for D-alanine esterification of
FT                   lipoteichoic acid and wall teichoic acid"
FT                   /db_xref="GOA:Q92D50"
FT                   /db_xref="InterPro:IPR006998"
FT                   /db_xref="InterPro:IPR023896"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D50"
FT                   /protein_id="CAC96201.1"
FT                   /translation="MKKKLWMTFGPLLVAFAVFLFVLFGPSSLFSYVSSETVEKSATSM
FT                   NEYVIQGLDIQKEALKEGNYLPIYGSSELSRVDPFHPSVVSKKYDQGYTPFLLGRPGTQ
FT                   SLSHFLDVNALGDDLRGKKVAVVLSPQWFQPKGVSDPSFGANFSPLHAYKFALEDAKNT
FT                   PERRYAAKRLLSFQVVQSDSTLKKLLENIVAKGPKKPHDPKLVKLAGNVELKILERKDD
FT                   LESKTVSGSKQDRIEKGLKDLPEKLDYKQLDDLAKETGEKSIGDNPFQVKEKYYQKKIK
FT                   PIEGKLKDSRKDLRYDESPEFGDLQLLMDAFKKAGADVIFINPPINGKWIDYIGMNKQG
FT                   LDGYYAKTKQQIESQGFRYYSLEQYQNDSFFLEDPIHLSWRGWVKIDQVLADFVKAPVQ
FT                   TNYTPTVDDYYIKSHPDNGPKKIQK"
     atgaaaaaaa agctgtggat gacatttggg cctttactgg tcgcattcgc ggttttcctt        60
     ttcgttctat ttggacctag cagcttattt tcttatgtgt cttcggagac tgtagaaaag       120
     agcgctacgt ctatgaacga atacgtcatc caaggcttag acatccagaa agaagcttta       180
     aaagaaggaa actatttacc aatttatggt tcttcagagc tttctcgtgt cgacccattt       240
     catcctagcg tagtctcaaa aaaatatgat caaggttata caccattcct attaggtcga       300
     ccgggtacac aatcattaag ccattttctt gatgtaaatg cacttggtga tgacttaaga       360
     ggcaaaaaag tggctgtagt tttatctcca caatggttcc aacctaaagg cgtttctgat       420
     ccatcgtttg gtgctaactt ctcccctctt catgcttata aatttgcact tgaagacgcg       480
     aaaaacacac ctgaacgcag atatgcagct aaaagattat tatcattcca agtggttcaa       540
     agcgactcta ctttaaagaa attacttgaa aacatcgtcg caaaaggtcc taaaaaacct       600
     catgatccaa aacttgtaaa acttgctggt aatgtcgaac tgaaaatttt agaacgtaaa       660
     gacgatttag aatcgaaaac agtttcaggt tctaaacaag atcgtataga aaaaggtcta       720
     aaagatctcc cagaaaaatt agattataaa caactagatg acctagcaaa agaaactggt       780
     gagaaaagta tcggtgacaa tcctttccaa gtgaaagaaa aatattacca gaaaaaaatc       840
     aaaccaattg aaggtaagct aaaagacagc cgtaaagatt tgcgttacga tgaatctcca       900
     gaatttggtg atttacaact tctaatggac gcattcaaaa aagctggcgc tgatgttatt       960
     ttcatcaatc ctcctatcaa cggtaaatgg attgactaca ttggtatgaa caaacaaggc      1020
     ttagatggtt actatgctaa aacaaaacaa caaatcgaga gtcaaggctt ccgttattac      1080
     tctctagaac aatatcaaaa tgattctttc tttttagaag atcctattca tttaagctgg      1140
     cgcggttggg taaaaatcga ccaagtcctt gctgattttg tcaaagcacc ggttcaaaca      1200
     aactatacac caacagtaga tgattattat attaaaagtc atccagataa tggaccaaaa      1260
     aaaatccaga agtag                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page