(data stored in ACNUC9435 zone)

EMBL: AL596167.EUTA

AL596167.EUTA        Location/Qualifiers
FT   CDS_pept        189795..191216
FT                   /transl_table=11
FT                   /gene="eutA"
FT                   /note="similar to ethanolamine utilization protein EutA
FT                   (putative chaperonin)"
FT                   /db_xref="InterPro:IPR009377"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CN3"
FT                   /protein_id="CAC96369.1"
FT                   /translation="MTETILSVGIDLGTSTTQLILSELEIQNMASSFTVPRIVISDKRI
FT                   IFRSEILFTPILADNLIDVDAIRDFVTKEYANAGIKKEEIGMGAVIITGETARKDNASN
FT                   VLDAMSGFAGDFVVATAGPDLESIIAGKGAGAHTYSKENSTCVVNLDIGGGTTNLSLFD
FT                   RGELIDTACLDIGGRLIKVDRETRKITYIAPKIQALIEKRGYPITLGEKTSPENLQPIL
FT                   GEMVELLKNSVGLGAPNDFYETIITNKGLKFLAEIECISFSGGVADCISTGALSDPFRY
FT                   GDIGLLLGKSIAESSLMTEKKYIESVETIRATVVGAGSHTAEISGSTITYTEKIFPVKN
FT                   IPILKLAKQEENENMAEVIKEKLNWFKIDEDMERIALAIEGENSPSFQQVTEYAKAICE
FT                   GMKEPISLGHPLIIITWHDMAKALGQSIFGHLPAGYPLICLDSVKVDNGDYIDIGKPVA
FT                   DGKVLPVVVKTLVFN"
     ttgacggaaa cgattttaag tgtagggatt gaccttggta cgtcgacaac acaactcatt        60
     ttatccgagt tagaaattca aaatatggca tcaagcttca cagtgccgcg cattgtgatt       120
     tcagataagc gaatcatttt tagaagcgag attcttttta caccgattct tgctgataat       180
     ttaattgatg tagatgcaat tcgtgatttt gtaacgaaag aatatgcgaa tgctgggatt       240
     aagaaagaag aaatcggcat gggggcagtt attattacag gtgaaacggc tcgtaaagat       300
     aatgcgagta acgttctaga tgcgatgagc ggttttgcag gagactttgt cgttgctaca       360
     gctggacctg atttagaaag tattattgct ggaaaaggag caggtgcgca tacttattct       420
     aaagaaaata gtacttgtgt tgtgaatctg gatataggtg gcgggacaac aaatttatcg       480
     ctatttgatc gcggtgagct tattgataca gcatgccttg atattggtgg tcggttaatc       540
     aaagtggacc gtgaaacaag aaaaatcacc tatattgccc caaaaattca agctttaata       600
     gaaaaacgtg gttatccaat cacgctaggt gagaaaacct cgccagaaaa tttacaacca       660
     attctaggtg aaatggtaga gttacttaaa aacagtgtcg gtcttggagc tccaaatgat       720
     ttttacgaaa caatcatcac aaataaaggc ttaaaattcc ttgctgaaat tgaatgtatt       780
     tctttttcag gcggtgtggc tgattgtatt tcaactggtg ctttaagtga tccgtttaga       840
     tacggagata ttggtctttt actcggaaag tcaatagctg aatctagctt gatgaccgaa       900
     aaaaagtata tcgaatctgt cgaaaccata cgggcaactg tggtaggagc cggttcacac       960
     acagcagaaa ttagtggtag tacaatcact tataccgaga aaattttccc agtaaaaaac      1020
     attcctattt tgaaacttgc caaacaagaa gaaaatgaaa atatggcaga agtcatcaag      1080
     gaaaaactca actggttcaa aatagatgaa gatatggaac ggattgcact tgcaattgaa      1140
     ggggagaata gccccagttt ccagcaagta acagaatatg caaaggccat ttgcgagggg      1200
     atgaaagaac cgatttcact tgggcaccca ctaattatca ttacttggca cgacatggca      1260
     aaagcgctcg gacaaagtat tttcgggcat ttaccagccg gctatccact gatttgtttg      1320
     gatagtgtca aagtcgataa cggtgattat attgatatag gaaaaccagt tgctgacggg      1380
     aaagtgctac cagtagtagt aaaaacctta gtctttaact ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page