(data stored in ACNUC9435 zone)

EMBL: AL596167.GBUA

AL596167.GBUA        Location/Qualifiers
FT   CDS_pept        70436..71629
FT                   /transl_table=11
FT                   /gene="gbuA"
FT                   /note="highly similar to glycine betaine ABC transporter
FT                   (ATP-binding protein)"
FT                   /db_xref="GOA:Q92D08"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D08"
FT                   /protein_id="CAC96244.1"
FT                   /translation="MSKIKVEELTKIFGKKASKASSLLSQGKSKTEILKETGATIGVNK
FT                   ASFSVEEGEIFVIMGLSGSGKSTLVRLLNRLIEPTSGKIWLDGKELSSLNKKELLEVRR
FT                   KSMSMVFQNFGLFPNRTINRNVEYGLEIQGMNKEEREKNAAESLALVGLAGYGEQYPSQ
FT                   LSGGMQQRVGLARALANNPDILLMDEAFSALDPLNRKDMQDQLLDLQDKMKKTIIFITH
FT                   DLDEALRIGDHIMIMRDGSVVQTGSPEEILAHPANEYVEKFIEDVDRSKVYTASNVMIR
FT                   PEIVNFEKDGPRVALKRMREAGTSSVFVVKRNRELVGIVHAAEVSKLVKENITSLETAL
FT                   HSDVPTTGPDTPLAEIMDTISTTTIPIAVTEDGKLKGIIIRGSVLAALSGNEVNVNA"
     ttgagcaaga ttaaagtgga agaactaacg aagatttttg gaaaaaaggc ttctaaagca        60
     tcttctttac tttctcaagg gaaatcgaaa acagagattt tgaaagaaac aggggcgact       120
     attggtgtta ataaagcatc ttttagcgta gaagaaggag aaattttcgt tataatgggg       180
     ctttctggta gtgggaagtc aactttggta cgacttttaa accgtctaat tgagcctacg       240
     agcggaaaaa tttggctgga cggaaaagaa ctctctagtt taaataaaaa agaacttttg       300
     gaagttagaa gaaaaagcat gagtatggtc ttccaaaatt ttggtttatt tccaaataga       360
     acgattaacc gtaatgttga atacgggctt gaaattcaag gaatgaacaa agaagaacgt       420
     gagaaaaatg cagcagaatc gcttgcactt gttggtttag ctggttacgg cgaacaatat       480
     ccttcccaac tttctggtgg gatgcagcaa cgtgtagggc tagcgagagc acttgctaac       540
     aatccagata ttttattaat ggatgaggct ttctcagcac ttgacccact taacagaaaa       600
     gacatgcaag atcaactact agatttacaa gataaaatga agaaaacaat catctttatt       660
     acccatgatt tggatgaggc gcttcgtatt ggcgaccaca ttatgattat gcgtgatggt       720
     tctgttgttc aaactggttc cccggaagaa attctggcac atccagcaaa tgaatacgta       780
     gaaaaattca ttgaagatgt agaccgttcc aaagtttata cagcgagcaa cgtaatgata       840
     cgcccagaaa tcgttaattt tgaaaaagac ggccctcgtg tcgctttaaa acggatgcgt       900
     gaagctggaa catctagtgt atttgttgtt aagcgtaacc gtgagttagt tggtattgtc       960
     catgcagcgg aagtttctaa actagttaaa gaaaatatta cttcgcttga aactgcttta      1020
     cacagtgatg taccgacaac tggtccggat acgccacttg cagaaatcat ggatactatc      1080
     tcgacaacaa cgattccaat cgctgtaacc gaagatggaa aattaaaagg aattattatt      1140
     cgcggatctg ttctggccgc actttctgga aacgaggtga acgttaatgc ctaa            1194
//

If you have problems or comments...

PBIL Back to PBIL home page