(data stored in ACNUC9435 zone)

EMBL: AL596167.GBUC

AL596167.GBUC        Location/Qualifiers
FT   CDS_pept        72484..73386
FT                   /transl_table=11
FT                   /gene="gbuC"
FT                   /note="highly similar to glycine betaine ABC transporters
FT                   (glycine betaine-binding protein)"
FT                   /db_xref="GOA:Q92D06"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D06"
FT                   /protein_id="CAC96246.1"
FT                   /translation="MLKKLITTAVLAMLIFTLAACGTTLAPYDAKKDLGEQINYTITGI
FT                   DAGAGIMLATQNAIKDYHLDDDNWQLQTSSTAAMTSTLQKAMKDKRPIVVTGWTPHWMF
FT                   TKFDLKFLDDPKNVFGNAENIHTIVRKGLKEEKPSAYKVLDNFFWTAEDMSEVMLEVND
FT                   GVDPEEAAKKWIKNNPEKVAKWTDGVEKVDGDEIKLTYVAWDSEIASTNVVAEALKQVG
FT                   YKPTIQAMEIQPMWASVATDAADGMVAAWLPNTSGIYYKDYKGKFEDLGPNLKGAKIGL
FT                   AVPKYMTNINSIEDLKISK"
     ttgctaaaaa aattaatcac caccgcagtt ttggctatgc ttattttcac tttagcagcc        60
     tgcgggacaa cccttgctcc ttatgacgcg aaaaaagatt taggcgaaca aatcaattat       120
     acaatcacag gaattgatgc tggagcagga attatgcttg caacacaaaa tgcgattaaa       180
     gattatcatt tagatgatga caattggcag ttacaaacaa gttcgactgc ggctatgact       240
     agtacactac aaaaagcgat gaaagataag cgcccgattg ttgtgactgg ttggacacct       300
     cactggatgt ttacaaaatt cgacttgaaa tttttagatg atcctaaaaa tgtttttgga       360
     aacgctgaaa atatccacac aattgtccgc aaaggtttga aagaagaaaa accttctgcc       420
     tacaaagtgc tagataattt cttctggact gctgaagata tgtctgaagt aatgctagaa       480
     gttaatgacg gagtagatcc agaagaagct gctaaaaagt ggattaaaaa caatccagaa       540
     aaagtagcaa aatggaccga tggcgtggaa aaagtagatg gcgatgaaat caagcttact       600
     tatgtagctt gggattcaga aattgcctcc acgaatgttg ttgcagaagc tttgaaacaa       660
     gttggctata aaccaaccat tcaagcaatg gaaattcaac caatgtgggc gtctgtcgcc       720
     acagatgcag cagatggaat ggtcgctgca tggctaccaa acacttccgg aatctactac       780
     aaagattaca aaggaaagtt tgaagattta ggaccgaact taaaaggtgc gaaaatcggc       840
     ttagcagttc caaaatacat gacaaacatt aactccattg aagatttaaa aataagtaaa       900
     taa                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page