(data stored in ACNUC9435 zone)

EMBL: AL596167.GLPF

AL596167.GLPF        Location/Qualifiers
FT   CDS_pept        181739..182443
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /note="similar to glycerol uptake facilitator protein"
FT                   /db_xref="GOA:Q92CP0"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP0"
FT                   /protein_id="CAC96362.1"
FT                   /translation="MSAYLAEFIGTMVLIMFGNGLLAGLTLNKSLSQGANWVVVTFGWG
FT                   FAVMIGIYVAGAYSGAHLNPAVTIALAVGGSFSWAAVVPYIIAQIAGAFVGASIIILHY
FT                   YPHFKATPQEIDTHGIFSTGPAIRNTPFNLISEIIATFAFIFGLLMIGENSFTNGLNPL
FT                   ILGFLVVAIGMSFGPTTGYAINPARDLGPRLAYFLLPVPNKSGSDWRYAWIPIVGPIIG
FT                   GLLAIGLFNILL"
     atgtcagcat atttggcgga atttattgga acgatggtac ttattatgtt tggtaatggg        60
     cttttagcag gtttaacatt aaataaatca ttatcacaag gagcaaactg ggtagttgtt       120
     acatttggtt ggggttttgc tgtaatgatt ggtatttatg tcgctggagc atatagcgga       180
     gcgcacttaa atccagcagt aactattgcg cttgcagttg gaggttcatt ctcttgggca       240
     gctgtagttc cgtacattat cgcccaaatc gccggagcat ttgtcggagc atcgattatt       300
     attttacatt attatccgca ttttaaagcc acaccacaag aaattgatac acacggtatt       360
     ttttctactg gaccagcgat tcgaaataca ccgttcaact taatcagtga gattattgca       420
     acgtttgcct tcatttttgg attacttatg atcggcgaga atagttttac aaatggttta       480
     aatccgttaa ttctcggttt cttagtagtt gcaatcggaa tgagctttgg accaacgaca       540
     ggttatgcga ttaacccagc tcgtgattta ggaccaagac ttgcttactt tttactacca       600
     gtaccaaata aaagtggatc agactggcgt tacgcttgga ttccaattgt cggaccaatc       660
     attggcggtc tcttagccat tggactattt aacattttat tataa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page