(data stored in ACNUC9435 zone)

EMBL: AL596167.LEMA

AL596167.LEMA        Location/Qualifiers
FT   CDS_pept        21794..22351
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /product="Listeria epitope LemA"
FT                   /db_xref="GOA:Q92D59"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D59"
FT                   /protein_id="CAC96192.1"
FT                   /translation="MIGWIIAIAVVVILVLIYFGLYNSLVKYRNRVDETWAQIDVQLKR
FT                   RFDLIPNLVETVKGYATHEKETLTQVIEARNKMMEVPADNRQGQIEADNMLSGALKSIF
FT                   ALGEAYPDLKANTSFIELQHELTTTENKVAYSRQLYNTTVMTYNTKVQSVPTNIVAKLH
FT                   NFKERDMLSIPEVERVAPKVEF"
     atgataggat ggattattgc tatcgctgtt gttgtaattc tagtattgat ttatttcggt        60
     ctatacaaca gccttgtaaa ataccgtaac cgtgttgacg aaacttgggc gcaaattgac       120
     gtacaattaa aacgtcgctt tgacttgatt cctaatttag ttgaaacagt taaagggtat       180
     gcaacacatg aaaaagaaac actaacacaa gtaattgaag ctcgtaacaa aatgatggaa       240
     gttcctgctg acaaccgtca agggcaaatc gaagcagata atatgctaag tggggcgctt       300
     aaatctattt ttgcattagg tgaagcttat ccagacttaa aagcaaatac ttccttcatc       360
     gaattacaac atgaactaac tactacggaa aacaaagtgg cgtattctcg ccaactttat       420
     aacacaaccg taatgactta taacacaaaa gtacaatcag taccaacaaa catcgtagca       480
     aaactgcata actttaaaga acgcgatatg ctttcgattc cagaagtaga gcgtgttgca       540
     ccaaaagtag agttttaa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page