(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0937

AL596167.LIN0937     Location/Qualifiers
FT   CDS_pept        complement(1351..1809)
FT                   /transl_table=11
FT                   /gene="lin0937"
FT                   /note="similar to protein-tyrosine-phosphatase"
FT                   /db_xref="GOA:Q92D81"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D81"
FT                   /protein_id="CAC96168.1"
FT                   /translation="MVKVVFVCLGNICRSPMAEGLFRKEVANAGLTDEIEIDSAATGTW
FT                   NLGKPPHRGTREVLKKHGINYEAMRARKVTDADFEQADYIIGMDQNNIADLNALNKNKD
FT                   VTLRSLMSFVSGKEEEEIPDPYYTGDFDETERMVTEGVKALLAFITKK"
     ttggtaaaag tagtatttgt atgtttagga aatatttgcc gttctccaat ggcagaagga        60
     ctttttcgaa aagaagttgc taatgcaggg ttaacggatg aaatagaaat tgattctgcg       120
     gcaacgggaa catggaactt aggaaaacca ccgcaccgtg gtacaagaga agttttgaaa       180
     aagcacggta ttaattatga agcaatgcgt gctcggaaag taacggatgc cgattttgaa       240
     caagctgatt atattattgg gatggatcaa aataatatag ctgatttaaa tgctcttaat       300
     aaaaacaaag acgtaactct tcgttcactg atgtcctttg tttcaggcaa ggaagaggaa       360
     gaaattcctg atccttatta cactggtgat tttgatgaaa cagagcgaat ggtaacggaa       420
     ggagtcaaag cccttttagc ttttattaca aaaaaatag                              459
//

If you have problems or comments...

PBIL Back to PBIL home page