(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0941

AL596167.LIN0941     Location/Qualifiers
FT   CDS_pept        complement(3742..5436)
FT                   /transl_table=11
FT                   /gene="lin0941"
FT                   /note="similar to heat shock protein HtpG"
FT                   /db_xref="GOA:Q92D78"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D78"
FT                   /protein_id="CAC96172.1"
FT                   /translation="MENYSHRFQVNLAGMIDILSNHLYDEKDVYIRELLQNATDAIRAR
FT                   KKIEPTLNGKIHVSLSGEKNNKTLILEDNGIGLTEDEVHAFLATIANSSKGEKNFDGQD
FT                   TNDFIGRFGIGLLSCFIVSDEIVMISTSQKNGETTEWHGKADGTYSVRKIKTEKREPGT
FT                   QVYLRLRPHMDEHPECEKTEYLINTLKKYGSSLESAILIEADGYEQEINSWTKQFADKE
FT                   ILFSLPREQILRYGEHLLGTRFQDYFLIENESGRTFGIAFMIPYTVQMNAVRKQTVFLN
FT                   NMYVTSEANNVLPNWAFFAECILWTDELQPVASRESFYKNERLEIVSKELGVALKKGIE
FT                   TLPESALTKLLSTHYLGFKALASEDAPFLKLIYSYLPFKTLNGEEKLADIMKETTTIYY
FT                   TFSVDDFRQITDIARSSGMTLINGGYSYDTPILTMLNHLVDEAEFILIQPEEITNKLLP
FT                   MSAEEEITYQPILAEMNKMMAEFDADITIKHFEPKTLPIIFIHSAATQASRELERSLEE
FT                   TSSVFSDILESIQQEQAPAPLAHLYLNLDNELIKNFSRLVNLLMSYR"
     atggaaaatt attctcaccg ctttcaggtg aacttggctg gtatgattga cattctctct        60
     aatcatcttt atgacgaaaa agatgtttat attcgagaat tattacagaa tgctacagat       120
     gcaattagag ctaggaagaa aatagagcct actttaaatg gaaaaatcca tgtttcatta       180
     tctggtgaaa aaaacaacaa aactttaatt ttagaggata atgggattgg tttaacggaa       240
     gatgaagtcc atgccttcct tgcaactatt gctaattcat ctaaaggtga aaaaaacttt       300
     gatggtcaag ataccaatga ttttattggt cgctttggga tcggtttact ttcttgtttt       360
     attgttagcg atgagattgt aatgatttct acctcacaaa aaaacggaga aacgactgaa       420
     tggcatggaa aagctgatgg tacttattct gtccgtaaaa ttaaaaccga aaaacgcgaa       480
     cctggtactc aagtttattt acggttgcgt cctcatatgg atgaacaccc tgaatgcgaa       540
     aaaacggaat acttgattaa tacattaaaa aaatacggct cttctttaga aagcgccatt       600
     ttaatagaag cagatggtta tgaacaagag attaactcgt ggaccaagca gtttgctgat       660
     aaagaaatac tgttcagtct tccgagggag caaattcttc gctacgggga acatttactc       720
     ggcactcgct ttcaagatta tttcttaatt gaaaatgaat ctggtcgtac ttttggaatc       780
     gcttttatga ttccttatac ggtgcaaatg aatgcggtgc gcaaacaaac ggtattttta       840
     aacaatatgt atgtgacgag cgaagcgaat aacgttcttc ctaactgggc tttttttgct       900
     gaatgtatac tttggacaga tgagcttcag ccagtcgctt cacgggaatc tttttataaa       960
     aatgagcgcc ttgaaatcgt atctaaggag ctaggtgtgg cgctaaaaaa aggaattgaa      1020
     acgttacccg agagcgcact aacaaaatta ttatcgacgc attatcttgg ttttaaagca      1080
     ttagctagtg aagatgcgcc atttttaaaa ttaatttatt cttatctgcc gtttaaaact      1140
     ttgaatggtg aagaaaaatt agcagatata atgaaagaaa cgacgacaat ctactatact      1200
     ttttcagtag acgattttag acagataact gatattgctc gctctagtgg tatgacattg      1260
     attaatggcg gttactccta cgatacacca attttaacaa tgttaaatca tttggtagat      1320
     gaagccgagt ttattttaat tcaaccagaa gaaatcacta acaaattgtt accaatgtct      1380
     gctgaagaag aaataactta tcaaccaatc ttagctgaaa tgaataaaat gatggcggaa      1440
     tttgatgccg atataacaat taagcatttt gaacctaaaa cgctccctat tatttttatt      1500
     cattctgccg ctacacaggc aagcagagaa ctggaacgct ctttagaaga aacgagttct      1560
     gttttcagtg atattttaga gagtattcag caagaacaag cccctgctcc acttgcccat      1620
     ttgtatttaa atttagataa tgagcttata aaaaactttt cacgtctggt aaatctatta      1680
     atgagttatc ggtga                                                       1695
//

If you have problems or comments...

PBIL Back to PBIL home page