(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0943

AL596167.LIN0943     Location/Qualifiers
FT   CDS_pept        6343..6645
FT                   /transl_table=11
FT                   /gene="lin0943"
FT                   /note="similar to B. subtilis YneR protein"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR008326"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D77"
FT                   /protein_id="CAC96174.1"
FT                   /translation="MNIEVTDQANKWFHDEFDVADGNGIRLFAKYGGSNSSLHPGFSIG
FT                   LAAEKPQEAAVAEKKEDLTFFIEDHDYWYFKDHDWKIDYEPKTEEVSFSFKEKVK"
     atgaatatcg aggtaacgga ccaagcaaat aaatggtttc atgatgaatt tgatgtagct        60
     gatggtaatg gaattcgact ttttgccaaa tatggtggtt ctaatagttc cttgcatcct       120
     ggtttctcta tcggtttagc tgccgaaaaa ccgcaagaag cagcagtcgc tgaaaagaaa       180
     gaagacttaa ctttctttat tgaagatcat gattattggt atttcaaaga ccacgactgg       240
     aaaattgact atgaaccaaa aacggaagaa gtatcctttt cctttaaaga aaaagtgaaa       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page