(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0944

AL596167.LIN0944     Location/Qualifiers
FT   CDS_pept        6760..7890
FT                   /transl_table=11
FT                   /gene="lin0944"
FT                   /note="similar to C-terminal part of B. subtilis ComEC
FT                   protein and to ComEA "
FT                   /db_xref="GOA:Q92D76"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D76"
FT                   /protein_id="CAC96175.1"
FT                   /translation="MTKKLVICISLIAIFLSGCSFSEPSTKPSNITEKTLNGASFTFFD
FT                   VGQGDSTLIQAEDGTTILIDTGRQDDDRILTYLKEANIKKLDLLLLTHPHADHIGNADK
FT                   VIATYKPKEIWMDGLTFSSSIYEKVIDAALASNAKYKEPRRGDKATFGPFDIEVLSPDK
FT                   LQNDANNDSIAVKMTYKDISAIFTGDAEKGREREMADSGANLEADILDLGHHGSSTSNQ
FT                   PFFLDKVKPQVAVYSAEMANSYGHPHVEVLEWLKERDIKTYGTDVNGTITIETDGEKIH
FT                   VQTEKEGTPKPGSSYNKENNTQKTEDATSEELPESINLNSASSEELQLLPLIGPALAEK
FT                   IIAERPYQSIDELKKINGIGDGIVRQIKEQGLAVTK"
     atgacaaaga aattagtaat ttgtattagt ttaatcgcga tatttttaag cggttgtagt        60
     ttttcagaac catccactaa accatctaac atcacagaaa aaaccttaaa tggtgcaagc       120
     tttacttttt ttgatgttgg tcaaggggac agcacactta ttcaagcaga agacggtacg       180
     actattttga ttgatactgg tcgacaagat gatgaccgga ttttaactta tttaaaagaa       240
     gcaaatataa aaaagctaga tttgctatta ctgacacatc cacatgccga ccatattggt       300
     aatgccgaca aagtcattgc tacatataaa ccgaaagaaa tttggatgga tggcttaact       360
     ttttcaagca gtatttatga gaaggtaatt gatgcagcac tggcctcaaa tgcgaaatat       420
     aaagaaccaa gacgcggtga taaagcgact tttggtccat ttgatataga agtcctaagc       480
     ccagataaac ttcaaaacga cgccaataat gactccattg cagtcaaaat gacatacaaa       540
     gatatttctg ccattttcac tggtgatgcg gaaaaagggc gggaacgaga aatggcagat       600
     agtggcgcca atttagaagc agatatttta gacttaggac accatggttc atccacttct       660
     aatcaaccat ttttcttaga taaagtgaaa cctcaagtgg ctgtatactc cgctgaaatg       720
     gccaacagtt atggacatcc ccatgtagaa gtattggaat ggttaaaaga acgagatatt       780
     aaaacttacg ggacagatgt gaatggaaca attacaatcg aaactgacgg cgaaaaaatt       840
     catgtccaaa ccgaaaaaga aggcacccct aagcccggta gcagctataa caaagaaaat       900
     aatacacaaa aaacagaaga tgccacatca gaagaattgc ctgaaagtat taatctgaat       960
     tcagcatcta gtgaagaatt acaactatta ccacttattg gcccagcgct ggcagaaaaa      1020
     atcattgccg agcgcccgta tcagtccata gatgaattga aaaaaattaa cggcattggt      1080
     gatggaattg tgcgccaaat taaagaacaa ggccttgccg taacaaagta g               1131
//

If you have problems or comments...

PBIL Back to PBIL home page