(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0946

AL596167.LIN0946     Location/Qualifiers
FT   CDS_pept        complement(8326..9543)
FT                   /transl_table=11
FT                   /gene="lin0946"
FT                   /note="hypothetical transport protein"
FT                   /db_xref="GOA:Q92D74"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D74"
FT                   /protein_id="CAC96177.1"
FT                   /translation="MNSDLTNKKILTRSSRVMLIVGIILIAANLRAPITSVGPLLGMIQ
FT                   SDLHLTNTMAGLLTTIPLLAFAGLSPFVSKLSRSLGIEVLIFIALLTLVIGSLLRPFGG
FT                   EFYLFAGTFMIGLAIAVGNVILPSLIKKEFPFKLGLMTGVYSISMNLCAALAAGLTVPI
FT                   AMNNKFSWHGSMVFWAMLGVLALVIWLPQLRYNQRSSEKIATHLVTTSVWKSPLAWKIS
FT                   LYMGSQSAIFYISIAWLPNILADQGLSSTSSGLMLSLMQFAVMPITFIIPIIAGRMKNQ
FT                   QLLVGISVLLFMIGIFGIMFASGNLFILATAIILYGIGSGMSFSLSMMFFNLRTTSATE
FT                   SADLSGMAQSIGYLFAASGPILFGTLHDALGSWQPTLYVLIGITLIMLYCGLDAGRNKF
FT                   LFPQKK"
     atgaattcag atttaacaaa taaaaaaatc ctgacgcgtt caagtcgggt gatgcttatt        60
     gtcggcatta ttttaattgc agcaaacttg cgtgcaccaa ttacgtcagt tggaccttta       120
     cttggaatga ttcaatcaga tttacattta acaaacacga tggcaggatt actaacgacg       180
     ataccactac ttgcttttgc tggtttatcc ccttttgttt cgaaattaag tcgttcacta       240
     gggatagaag tacttatttt tatcgcactt ttaactcttg ttattggtag tttacttcga       300
     ccttttggag gcgaattcta tttatttgct gggacattta tgattggact tgctattgca       360
     gtgggaaatg tcattttacc tagtttgatt aagaaggagt ttccttttaa attaggatta       420
     atgactgggg tatattcgat ttcaatgaat ttatgtgcgg cacttgctgc tggtttgacg       480
     gtgccgattg cgatgaataa taaattcagc tggcatggaa gcatggtttt ttgggcaatg       540
     ctgggtgttt tagcgttagt tatctggcta ccacagttaa gatataacca acgcagctca       600
     gaaaaaattg ccacacattt agttactact tcggtgtgga agtcccctct tgcttggaaa       660
     atttcattat atatgggttc acagtccgcg attttttata tttcgattgc ttggttaccg       720
     aacattttag cagatcaagg attatcaagt acttctagcg gtcttatgct ctcactaatg       780
     cagtttgctg ttatgccgat tacatttatt attcctatta tagctgggcg aatgaaaaat       840
     cagcagttgc tcgttgggat ttctgtttta ttatttatga ttgggatttt tgggattatg       900
     ttcgcttctg gtaatctatt tattttagct actgcgatta ttttatatgg gattggttcg       960
     gggatgtcat ttagtctttc gatgatgttc tttaatttgc gaacaacaag cgctaccgaa      1020
     tcggcggatt tatctggaat ggcgcaatca ataggttatt tgtttgctgc ttccggtcca      1080
     atattatttg gtacactcca tgatgctctt ggcagttggc aaccaacgtt atatgttctg      1140
     atcggcatta ccctaattat gctatattgc ggcctagatg ctggacgcaa taaatttctc      1200
     tttccacaga aaaagtga                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page