(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0948

AL596167.LIN0948     Location/Qualifiers
FT   CDS_pept        10351..11397
FT                   /transl_table=11
FT                   /gene="lin0948"
FT                   /note="conserved hypothetical membrane protein"
FT                   /db_xref="GOA:Q92D72"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D72"
FT                   /protein_id="CAC96179.1"
FT                   /translation="MNWLEKLKENDTARRVLVFVLLGIVLYLLRSMIDLILLTFIFAFL
FT                   VTRLENVILKRIRIPRKLIVIVLYCLVAMFLYVAIVHFLPILIDQISQLVDSLVKIYNN
FT                   PSDNKIVQWIVGFLKESNIQKYLQTGVDFIIASLSGIGSVGLSFFLALILSLFFSLEKE
FT                   RVTSFTGQFLTSKVGFIFKEAAFFGKKFVATFGVVLEAQLMIALVNTIITTIALYLMNF
FT                   PQLLSLSIMVFVLGLIPVAGVIISCVPLVLIAYSVGGFQDVVYILITVVIVHAIETYIL
FT                   NPKLMSSKTNLPVFYTFIILIFSETFFGVWGLIVGIPVFVFLLDILDVRNSEDIQKRTI
FT                   FGRKKKVD"
     atgaattggt tggagaagct aaaagaaaat gacacggcaa gacgggtgct agtgtttgtt        60
     cttctaggga ttgtattata tttacttaga agcatgatag atttaatatt actaacattt       120
     atttttgcat ttttagttac gcgattagaa aatgtaattt taaaaagaat acgaatacca       180
     cgaaaattaa tcgttatcgt tttatattgt ttagtagcaa tgtttttata tgttgctatt       240
     gttcatttct taccaatttt aattgaccaa atatcgcaac ttgtagactc tcttgtaaaa       300
     atttataata acccgagtga taataagatt gtgcagtgga ttgtcggatt tttgaaggaa       360
     tcgaatattc aaaaatacct ccaaactggt gttgacttta ttattgcttc actttctgga       420
     atcggttcgg ttggattatc gtttttctta gctttaatcc ttagtttgtt tttctcttta       480
     gaaaaagaac gggtaacttc ttttacaggg caatttttaa caagtaaagt aggctttatt       540
     tttaaagaag cagcgttttt tgggaaaaaa tttgttgcga ctttcggggt ggtgttagag       600
     gcacaattga tgattgcgct tgttaataca atcattacaa cgatagcact atatttaatg       660
     aatttcccac aacttcttag tctatccata atggtgtttg tattagggtt aattcccgtg       720
     gctggtgtaa ttatctcatg tgttccactt gttcttattg catactctgt tggtggtttt       780
     caagatgtcg tttatatttt aattacggta gttatcgttc atgcgattga aacatatatt       840
     ttaaatccga aactaatgtc ttccaaaacg aatttacctg tattttatac ctttatcatt       900
     ttaatttttt cagaaacttt ctttggcgta tggggcttaa ttgttggtat cccagtattt       960
     gtattcttac tggatattct agacgtacga aattctgaag atattcaaaa aagaactata      1020
     tttggacgta agaaaaaagt agattaa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page