(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0962

AL596167.LIN0962     Location/Qualifiers
FT   CDS_pept        22374..23288
FT                   /transl_table=11
FT                   /gene="lin0962"
FT                   /note="similar to putative heat shock protein HtpX,
FT                   Listeria epitope LemB"
FT                   /db_xref="GOA:Q92D58"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D58"
FT                   /protein_id="CAC96193.1"
FT                   /translation="MLFEQIAANKRKTVFIILGFFIFVLMVGAAIGIIVWNNYLNGLIL
FT                   AAAIGAVYILIMVMSSSSVVMAMNHAKEVTSKEQAPVLWDTVESMAMVAGIPMPKVYIV
FT                   EDPSPNAFATGISPEKGAVAVTRGLLNKLERYELEGVIAHEISHIRNYDIRLSTIAIAL
FT                   VAVIAILSDLAMRLIFWGSLTGGRNSRKSDNNNGGGAQIIIYVVALIFVILAPIIATAI
FT                   QFALSRNREYLADASAVELTRNPDGLIQALQKISGDTKKMEEVSASSESIYFSSPLKSK
FT                   KDKPGLFDSHPPISSRIERLENM"
     atgctatttg aacaaattgc agcaaataag cgaaaaactg tttttatcat tcttggcttt        60
     tttattttcg ttcttatggt tggggctgct ataggtataa ttgtttggaa taactatcta       120
     aatggactca tacttgcggc ggctattggt gcggtttata ttttgataat ggttatgagc       180
     agttcgtcgg ttgtcatggc gatgaatcat gcgaaagaag tcacctcaaa agagcaagca       240
     ccagttttat gggatactgt tgaaagcatg gcgatggttg ctggtatccc aatgccaaaa       300
     gtttatattg ttgaagatcc aagtccgaat gcatttgcaa ccggtatttc tcctgaaaaa       360
     ggcgccgtag ctgtcactag aggattgtta aataaattag aacgatatga gttagagggc       420
     gttattgcgc atgagatttc tcatattcgt aactatgata ttcgcttgtc gactattgcg       480
     attgccttag tcgcggttat tgctatccta agtgatttag ctatgcgttt gattttctgg       540
     ggtagcttaa caggcggaag aaatagccgc aaaagtgaca ataataatgg cggcggggca       600
     cagataatta tctatgtagt agcactaatt tttgttattt tagctccgat tattgctacg       660
     gcgattcagt tcgctttatc tagaaatagg gagtatttgg ctgatgcaag tgcagtagaa       720
     ttaactcgga atccagatgg gcttatccaa gcattacaaa aaattagcgg tgatacgaaa       780
     aaaatggaag aagttagcgc ttctagcgag tccatttact tttcgtcgcc attgaagtct       840
     aaaaaagata aaccaggtct tttcgattcc catccgccga ttagttcgcg aattgagcgg       900
     ttggaaaata tgtaa                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page