(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0963

AL596167.LIN0963     Location/Qualifiers
FT   CDS_pept        complement(23329..24147)
FT                   /transl_table=11
FT                   /gene="lin0963"
FT                   /note="similar to B. subtilis YjbH protein"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D57"
FT                   /protein_id="CAC96194.1"
FT                   /translation="MINQNLYYQSVANSKPIEIYLFFDPACDDCWNIEANMLRLQMEYG
FT                   NYFKLRYVLHNNLQTFVCKQKRAGNSNLSLKEQQIGAHLSYISCLAVKAAELQGKKQGI
FT                   TFLRKIQEAYFLENKDIASEEVLYEIAISTGLDLTEFKKDLASTAAKRAYIGDQKVAQE
FT                   MEIRENPTVVFFNKNIEDAGLKLSGLHRYEVYVHVLSELLNDFPEPEERPQMEEYLAKV
FT                   KVTSSASMAAFYGVSEQQIDRQMKKWRLQQKVELIDAPDGKPHWKYIGSL"
     atgattaacc aaaatttata ttatcagtca gtagctaatt ccaagcccat cgaaatttat        60
     ctattttttg atcctgcttg tgatgactgt tggaatattg aagcgaacat gctccggtta       120
     caaatggagt acgggaacta ttttaaattg cgctatgtgt tgcataataa tttgcagaca       180
     tttgtatgta aacaaaaacg cgctggaaat agtaacctaa gcttaaaaga acaacaaata       240
     ggggcgcacc tttcctatat ttcttgtctt gcagtcaaag ccgctgaact ccaaggaaaa       300
     aaacaaggta ttacattcct gcgtaagatt caagaagctt attttcttga gaataaagac       360
     atcgctagtg aagaagtact ctatgaaatc gctatttcca ccggtctaga tcttactgaa       420
     ttcaaaaaag atttagcatc tactgctgct aagcgcgcct atattggcga ccaaaaagta       480
     gcacaagaaa tggaaatacg cgaaaatcca acagtagttt tcttcaataa aaatatagaa       540
     gacgctgggt taaaattaag tggcctacat cgttatgagg tctacgtaca tgttttatcc       600
     gagcttttaa atgatttccc agaaccagaa gagcgcccac aaatggaaga atatttagct       660
     aaagtaaaag ttacttcttc tgcttccatg gcagcctttt acggggtttc tgaacaacaa       720
     attgaccgcc aaatgaagaa atggcgcctt caacaaaaag tagaattaat cgatgctcca       780
     gatggcaagc ctcactggaa atatatcggt agcttataa                              819
//

If you have problems or comments...

PBIL Back to PBIL home page