(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0964

AL596167.LIN0964     Location/Qualifiers
FT   CDS_pept        complement(24393..24977)
FT                   /transl_table=11
FT                   /gene="lin0964"
FT                   /note="similar to B. subtilis YjbK protein"
FT                   /db_xref="InterPro:IPR009195"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D56"
FT                   /protein_id="CAC96195.1"
FT                   /translation="MVKELEIEFRNLLTKEEYDRLIEDFRIKEDDFFEQTNFYLDTADF
FT                   GLKERNSALRIRKLETQYQLTLKTPEARGLMETTQILAADQATAITDGANIPVGPVRDT
FT                   LKEIGINHEDLQVFGSLKTIRAEKDYKKGLLVFDKNFYGSISDFDLEYEVSDYDKGKEI
FT                   FDKLLKEYQITNHPAENKVARFYNHVYKNND"
     atggtaaaag aactagaaat agaattccgc aatcttttga caaaagagga atatgatcga        60
     cttatagagg attttcgaat taaagaagat gatttttttg aacaaactaa tttttattta       120
     gatacggcag atttcggctt aaaagaacgt aactctgctc ttcggattcg taagttagaa       180
     acacagtacc aattaacact aaaaactcct gaggctcgcg gtttaatgga aacaactcaa       240
     attttagccg cagatcaagc aacagccatt acagacggag caaatattcc agttggtcca       300
     gtgcgcgata ctttaaaaga aatcggtatt aatcatgaag atttgcaagt ctttggttcg       360
     cttaaaacaa tccgtgccga aaaagattat aaaaaaggac tactcgtatt cgacaaaaat       420
     ttctatggtt ctatttcaga ttttgattta gaatatgaag tttctgatta cgataaagga       480
     aaagaaattt ttgataaact actcaaagaa tatcaaataa cgaatcatcc agcagaaaac       540
     aaagtagctc gtttttataa tcatgtgtat aaaaataatg actaa                       585
//

If you have problems or comments...

PBIL Back to PBIL home page