(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0966

AL596167.LIN0966     Location/Qualifiers
FT   CDS_pept        25620..26288
FT                   /transl_table=11
FT                   /gene="lin0966"
FT                   /note="similar to B. subtilis YjbM protein"
FT                   /db_xref="GOA:Q7AP16"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP16"
FT                   /protein_id="CAC96197.1"
FT                   /translation="MNHWEDFLAPYKQAVEELKIKLKGMRSQFELENNHSPIEFVTGRV
FT                   KPVASILDKANQKHIALDHLVEEMQDIAGLRMMCQFVDDIEVVVRLLRQRNDFRIVEER
FT                   DYITNKKPSGYRSYHVVIEYPVETIQGEKKILAEIQIRTLAMNFWATIEHSVNYKYQGE
FT                   FPEAINKRLKRAAEAAFQLDEEMSQIREEIQEAQVYFSQNKDVSKDKKAVHQVMPKKNK
FT                   "
     ttgaatcatt gggaagactt tttagcgcct tataaacagg cagtagaaga acttaaaatt        60
     aaacttaaag gaatgcgttc acaatttgag cttgaaaata atcattcgcc aattgaattt       120
     gttacaggac gagtgaagcc agttgcgagc atattagaca aagctaatca aaaacatatc       180
     gcacttgacc atttagtgga agaaatgcaa gatattgcgg gactgcgaat gatgtgtcaa       240
     tttgtagatg atattgaggt tgtcgttcgt cttttaaggc aacgcaatga ttttcggatt       300
     gtggaagagc gcgattatat tacaaataag aaacccagtg gataccgttc gtatcacgtc       360
     gttattgaat acccagtgga aacaattcaa ggtgagaaga agattttagc tgaaatccaa       420
     attaggacat tagcaatgaa tttttgggcg actattgagc attcggtaaa ctataaatac       480
     caaggcgaat ttccagaagc gattaataag cgactaaaac gcgctgccga ggcggctttt       540
     caattagatg aggaaatgtc gcaaattcgt gaagaaatac aagaagcgca agtctatttt       600
     tctcaaaaca aagatgtatc aaaggataaa aaagcggtgc atcaagtaat gccaaagaaa       660
     aataagtaa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page