(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0967

AL596167.LIN0967     Location/Qualifiers
FT   CDS_pept        26320..27114
FT                   /transl_table=11
FT                   /gene="lin0967"
FT                   /note="similar to conserved hypothetical proteins like to
FT                   B. subtilis YjbN protein"
FT                   /db_xref="GOA:Q92D53"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D53"
FT                   /protein_id="CAC96198.1"
FT                   /translation="MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDEIEPEIVISIGGD
FT                   GTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLK
FT                   TTVKYGIGKKEAEYLALNESTVKSSGGPFVVDVVINDLHFERFRGDGLCMSTPSGTTAY
FT                   NKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVD
FT                   HLSILHRDVQEIRYEVSAKKVHFARFRSFPFWRRVHDSFIED"
     atgaaatata tgattacttc aaaaggggac gagaagtcag atttgctgcg attgaatatg        60
     atcgctggtt ttggggaata tgacatggaa tatgatgaga tagaacctga aatcgttatt       120
     tctattggcg gagatggaac ttttttgtct gcgtttcatc aatatgaaga gcgcttagat       180
     gaaattgctt ttatcggaat tcatactggt catcttggct tttatgctga ttggcgccca       240
     gctgaagcag ataaattagt taagttatta gcaaaaggag aatatcaaaa agtttcttat       300
     ccactgctta aaactacagt aaaatacggc attggcaaaa aagaagctga gtatttagcg       360
     ctaaatgagt caaccgtaaa aagttcaggt ggaccttttg ttgtggatgt agttattaat       420
     gatctccatt ttgaacgatt ccgcggagat ggtttatgta tgtcaacacc aagcggaacg       480
     actgcatata ataaatcact cgggggagcg ctaatgcatc cgtccattga agcaatgcaa       540
     ttaactgaaa tggcgtcgat taataatcga gtttaccgga caattggtag tccactcgtt       600
     tttccgaagc atcatgtagt tagtttgcaa ccggtaaatg acaaggattt tcaaatttct       660
     gtggatcatt taagtatttt gcatcgtgat gttcaggaaa ttcgttatga agtatcagcg       720
     aaaaaagttc attttgcgag attcagatca tttccatttt ggcgtcgagt acacgattca       780
     tttattgaag attaa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page